|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 347252 |
Name | IGFBPL1 |
Synonym | IGFBP-RP4|bA113O24.1;insulin-like growth factor binding protein-like 1;IGFBPL1;insulin-like growth factor binding protein-like 1 |
Definition | IGFBP-related protein 10|insulin-like growth factor binding protein related protein 4|insulin-like growth factor-binding protein-like 1|insulin-like growth factor-binding-related protein 4 |
Position | 9p13.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
potential | IGFBP-RP4 may be a novel putative tumor suppressor protein. |
More detail of all 1 literatures about IGFBPL1 | |
External Links |
|
Links to Entrez Gene | 347252 |
Links to all GeneRIF Items | 347252 |
Links to iHOP | 347252 |
Sequence Information |
|
Nucleotide Sequence |
>347252 : length: 837 atgccgcgcttgtctctgctcttgccgctgctgcttctgctgctgctgccgctgctgccg ccgctgtccccgagccttgggatccgcgacgtgggcggccggcgccccaagtgtggtccg tgccggccagagggctgcccggcgcctgcgccctgcccggcgcccgggatctcggcgctc gacgagtgcggctgctgcgcccgctgcctgggagccgagggcgcgagctgcgggggccgc gccggcgggcgctgtggccccggcctggtatgcgcgagccaggccgctggggcagcgccc gagggcaccgggctctgcgtgtgcgcgcagcgcggcaccgtctgcggctccgacggtcgc tcgtaccccagcgtctgcgcgctgcgcctgcgcgctcggcacacgccccgcgcgcacccc ggtcacctgcacaaggcgcgcgacggcccttgcgagttcgctcctgtggtcgtcgttcct ccccgaagtgttcacaacgtcaccggggcgcaggtgggcctgtcctgtgaagtgagggct gtgcctaccccagtcatcacgtggagaaaggtcacgaagtcccctgagggcacccaagca ctggaggagctgcctggggaccatgtcaatatagctgtccaagtgcgagggggcccttct gaccatgaggccacggcctggattttgatcaaccccctgcgaaaggaggatgagggtgtg taccagtgccatgcagccaacatggtgggagaggctgagtcccacagcacagtgacggtt ctagatctgagtaaatacaggagcttccacttcccagctcccgatgaccgcatgtga |
Protein Sequence |
>347252 : length: 278 MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISAL DECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGR SYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRA VPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGV YQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |