|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3621 |
Name | ING1 |
Synonym | p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a;inhibitor of growth family, member 1;ING1;inhibitor of growth family, member 1 |
Definition | growth inhibitor ING1|growth inhibitory protein ING1|inhibitor of growth protein 1|tumor suppressor ING1 |
Position | 13q34 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 27 PubMed records as below. |
|
Evidence Status |
Description |
potential | Localization of the candidate tumor suppressor gene ING1 to human chromosome 13q34. |
potential | Cellular localization and chromosome mapping of a novel candidate tumor suppressor gene (ING1). |
potential | Extension of the replicative life span of human diploid fibroblasts by inhibition of the p33ING1 candidate tumor suppressor. |
potential | "A novel candidate tumor suppressor, ING1, is involved in the regulation of apoptosis." |
reviewed | The tumor suppressor p33ING1b upregulates p16INK4a expression and induces cellular senescence. |
reviewed | Genetic alterations of tumor suppressor ING1 in human non-small cell lung cancer. |
reviewed | The tumor suppressor ING1 contributes to epigenetic control of cellular senescence. |
reviewed | HECT ubiquitin ligase Smurf1 targets the tumor suppressor ING2 for ubiquitination and degradation. |
reviewed | Nuclear exclusion of p33ING1b tumor suppressor protein: explored in HCC cells using a new highly specific antibody. |
reviewed | Tethering by laminin A stabilizes and targets the ING1 tumor suppressor. |
| More detail of all 27 literatures about ING1 | |
|
External Links |
|
Links to Entrez Gene | 3621 |
Links to all GeneRIF Items | 3621 |
Links to iHOP | 3621 |
|
Sequence Information |
|
Nucleotide Sequence |
>3621 : length: 1269 atgtccttcgtggaatgtccttatcattcccctgcggaacgattggtcgctgaggcggat gaaggcgggcctagcgcaataactggtatgggtctgtgtttccgctgtcttcttttttct ttttcggggaggagcggggtggagggtggacgagttgatttgaacgtcttcgggtcgctc ggcctccagccttggattggttcttctcgctgctggggcgggccgtgctcttccgccctg cggtgtggttggttctcctcctggcctccgccctccaaatcggcgattcccataggcggc ggctctcggggtgcggggcgagtctcccgctggcctcctccccattggctggaggcctgg cgggtgtcgcccctgcccctctccccgctcagcccggccactttcgggcgcggatttata gcagtagcagtgatcccgggcctgtgggctcggggccggggctgcagttcggaccgcctc ccgcgacccgcggggccggctcggagacagtttcaggccgcatctctgctgacccgaggg tggggccgcgcgtggccgtggaaacagatcctgaaggagctagacgagtgctacgagcgc ttcagtcgcgagacagacggggcgcagaagcggcggatgctgcactgtgtgcagcgcgcg ctgatccgcagccaggagctgggcgacgagaagatccagatcgtgagccagatggtggag ctggtggagaaccgcacgcggcaggtggacagccacgtggagctgttcgaggcgcagcag gagctgggcgacacagcgggcaacagcggcaaggctggcgcggacaggcccaaaggcgag gcggcagcgcaggctgacaagcccaacagcaagcgctcacggcggcagcgcaacaacgag aaccgtgagaacgcgtccagcaaccacgaccacgacgacggcgcctcgggcacacccaag gagaagaaggccaagacctccaagaagaagaagcgctccaaggccaaggcggagcgagag gcgtcccctgccgacctccccatcgaccccaacgaacccacgtactgtctgtgcaaccag gtctcctatggggagatgatcggctgcgacaacgacgagtgccccatcgagtggttccac ttctcgtgcgtggggctcaatcataaacccaagggcaagtggtactgtcccaagtgccgg ggggagaacgagaagaccatggacaaagccctggagaaatccaaaaaagagagggcttac aacaggtag |
Protein Sequence |
>3621 : length: 422 MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSL GLQPWIGSSRCWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAW RVSPLPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRG WGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVE LVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE NRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQ VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY NR |