|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3651 |
Name | PDX1 |
Synonym | GSF|IDX-1|IPF1|IUF1|MODY4|PDX-1|STF-1;pancreatic and duodenal homeobox 1;PDX1;pancreatic and duodenal homeobox 1 |
Definition | IPF-1|IUF-1|glucose-sensitive factor|insulin promoter factor 1, homeodomain transcription factor|insulin upstream factor 1|islet/duodenum homeobox-1|pancreas/duodenum homeobox protein 1|pancreatic-duodenal homeobox factor 1|somatostatin transcription fact |
Position | 13q12.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "PDX1 expression is lost in gastric cancers. Its effect on cell proliferation/apoptosis, migration and tumor formation in vitro and in vivo suggested that this protein functions as a putative tumor suppressor in gastric cancer." |
| More detail of all 1 literatures about PDX1 | |
|
Pathways and Diseases |
|
Pathway | Regulation of beta-cell development;PID Reactome;500518 |
Pathway | Maturity onset diabetes of the young;KEGG PATHWAY;hsa04950 |
Pathway | Insulin Synthesis and Processing;PID Reactome;500128 |
Pathway | FOXA2 and FOXA3 transcription factor networks;PID Curated;200073 |
Pathway | Type II diabetes mellitus;KEGG PATHWAY;hsa04930 |
Pathway | Regulation of gene expression in beta cells;PID Reactome;500522 |
Pathway | Regulation of beta-cell development;Reactome;REACT:13698 |
Pathway | Regulation of gene expression in early pancreatic precursor cells;PID Reactome;500519 |
Disease | Maturity onset diabetes of the young (MODY);KEGG DISEASE;H00410 |
Disease | Alimentary system disease;FunDO |
Disease | Lacticacidemia due to PDX1 deficiency;OMIM |
Disease | diabetes, type 2;GAD |
Disease | Metabolic diseases;KEGG DISEASE |
Disease | Diabetes mellitus, type II, susceptibility to;OMIM |
Disease | Prostate cancer;FunDO |
Disease | Enteritis;FunDO |
Disease | Attention deficit hyperactivity disorder and conduct disorder;GAD |
Disease | MODY, type IV;OMIM |
Disease | Pancreas disease;FunDO |
Disease | PSYCH;GAD |
Disease | Diabetes;KEGG DISEASE |
Disease | Pancreatic agenesis;OMIM |
Disease | Neoplasm metastasis;FunDO |
Disease | METABOLIC;GAD |
|
External Links |
|
Links to Entrez Gene | 3651 |
Links to all GeneRIF Items | 3651 |
Links to iHOP | 3651 |
|
Sequence Information |
|
Nucleotide Sequence |
>3651 : length: 852 atgaacggcgaggagcagtactacgcggccacgcagctttacaaggacccatgcgcgttc cagcgaggcccggcgccggagttcagcgccagcccccctgcgtgcctgtacatgggccgc cagcccccgccgccgccgccgcacccgttccctggcgccctgggcgcgctggagcagggc agccccccggacatctccccgtacgaggtgccccccctcgccgacgaccccgcggtggcg caccttcaccaccacctcccggctcagctcgcgctcccccacccgcccgccgggcccttc ccggagggagccgagccgggcgtcctggaggagcccaaccgcgtccagctgcctttccca tggatgaagtctaccaaagctcacgcgtggaaaggccagtgggcaggcggcgcctacgct gcggagccggaggagaacaagcggacgcgcacggcctacacgcgcgcacagctgctagag ctggagaaggagttcctattcaacaagtacatctcacggccgcgccgggtggagctggct gtcatgttgaacttgaccgagagacacatcaagatctggttccaaaaccgccgcatgaag tggaaaaaggaggaggacaagaagcgcggcggcgggacagctgtcgggggtggcggggtc gcggagcctgagcaggactgcgccgtgacctccggcgaggagcttctggcgctgccgccg ccgccgccccccggaggtgctgtgccgcccgctgcccccgttgccgcccgagagggccgc ctgccgcctggccttagcgcgtcgccacagccctccagcgtcgcgcctcggcggccgcag gaaccacgatga |
Protein Sequence |
>3651 : length: 283 MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR |