|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3659 |
Name | IRF1 |
Synonym | IRF-1|MAR;interferon regulatory factor 1;IRF1;interferon regulatory factor 1 |
Definition | - |
Position | 5q31.1 |
Gene Type | protein-coding |
Source | Count: 4; Pubmed_search,TAG,Generif,UniProt |
Literature support | Count: 11 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Functionally inactivating point mutation in the tumor-suppressor IRF-1 gene identified in human gastric cancer. |
reviewed | A multiprotein binding interface in an intrinsically disordered region of the tumor suppressor protein interferon regulatory factor-1. |
reviewed | Docking-dependent ubiquitination of the interferon regulatory factor-1 tumor suppressor protein by the ubiquitin ligase CHIP. |
reviewed | IRF-1 could be nominated as one of the tumor suppressor factors and could aid in the early detection of HCC.-e. |
reviewed | Our findings strongly imply a tumor suppressor role for the IRF1 gene in breast cancer. |
reviewed | Cooperative regulation of the interferon regulatory factor-1 tumor suppressor protein by core components of the molecular chaperone machinery. |
reviewed | a novel repressor domain and differential gene regulation may contribute to IRF-1 tumor suppressor activity. |
reviewed | Data suggest that the dual effect of retinoids in increasing interferon regulatory factor-1 mRNA and nuclear protein may be essential for its tumor suppressor activity and immunosurveillance functions in breast epithelial cells. |
reviewed | Functional role for IRF-1 in the growth suppression of breast cancer cells and strongly implicate IRF-1 as a tumor suppressor gene in breast cancer that act to control apoptosis. |
reviewed | "a novel tumor necrosis factor (ligand) superfamily, member 10-mediated tumor suppressor activity of interferon regulatory factor 1 and suggest a mechanistic basis for the synergistic antitumor activities of certain retinoids and interferons". |
| More detail of all 11 literatures about IRF1 | |
|
Pathways and Diseases |
|
Pathway | Glucocorticoid receptor regulatory network;PID Curated;200077 |
Pathway | IL6-mediated signaling events;PID Curated;200124 |
Pathway | IL12 signaling mediated by STAT4;PID Curated;200197 |
Pathway | Hepatitis C;KEGG PATHWAY;hsa05160 |
Pathway | the information processing pathway at the ifn beta enhancer;PID BioCarta;100079 |
Pathway | IFN-gamma pathway;PID Curated;200110 |
Disease | Gastric cancer, somatic;OMIM |
Disease | Nonsmall cell lung cancer, somatic;OMIM |
Disease | Mycobacterium infection, Atypical;FunDO |
Disease | HEMATOLOGICAL;GAD |
Disease | Bladder cancer;FunDO |
Disease | Asthma;FunDO |
Disease | Hepatitis C;FunDO |
Disease | Breast cancer;FunDO |
Disease | Embryoma;FunDO |
Disease | hepatitis C;GAD |
Disease | IMMUNE;GAD |
Disease | Infection;FunDO |
Disease | Asthma;GAD |
Disease | Systemic infection;FunDO |
Disease | INFECTION;GAD |
Disease | Cervical cancer;FunDO |
Disease | Myelogenous leukemia, acute;OMIM |
Disease | Multiple sclerosis;FunDO |
Disease | Endometrial cancer;FunDO |
Disease | Myelodysplastic syndrome, preleukemic;OMIM |
Disease | Fibrinogen;NHGRI |
Disease | Hepatitis C, Chronic;GAD |
Disease | Graves' disease;FunDO |
Disease | Behcet syndrome;FunDO |
Disease | Celiac disease;FunDO |
Disease | fibrinogen;GAD |
|
External Links |
|
Links to Entrez Gene | 3659 |
Links to all GeneRIF Items | 3659 |
Links to iHOP | 3659 |
|
Sequence Information |
|
Nucleotide Sequence |
>3659 : length: 978 atgcccatcactcggatgcgcatgagaccctggctagagatgcagattaattccaaccaa atcccggggctcatctggattaataaagaggagatgatcttccagatcccatggaagcat gctgccaagcatggctgggacatcaacaaggatgcctgtttgttccggagctgggccatt cacacaggccgatacaaagcaggggaaaaggagccagatcccaagacgtggaaggccaac tttcgctgtgccatgaactccctgccagatatcgaggaggtgaaagaccagagcaggaac aagggcagctcagctgtgcgagtgtaccggatgcttccacctctcaccaagaaccagaga aaagaaagaaagtcgaagtccagccgagatgctaagagcaaggccaagaggaagtcatgt ggggattccagccctgataccttctctgatggactcagcagctccactctgcctgatgac cacagcagctacacagttccaggctacatgcaggacttggaggtggagcaggccctgact ccagcactgtcgccatgtgctgtcagcagcactctccccgactggcacatcccagtggaa gttgtgccggacagcaccagtgatctgtacaacttccaggtgtcacccatgccctccacc tctgaagctacaacagatgaggatgaggaagggaaattacctgaggacatcatgaagctc ttggagcagtcggagtggcagccaacaaacgtggatgggaaggggtacctactcaatgaa cctggagtccagcccacctctgtctatggagactttagctgtaaggaggagccagaaatt gacagcccagggggggatattgggctgagtctacagcgtgtcttcacagatctgaagaac atggatgccacctggctggacagcctgctgaccccagtccggttgccctccatccaggcc attccctgtgcaccgtag |
Protein Sequence |
>3659 : length: 325 MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN MDATWLDSLLTPVRLPSIQAIPCAP |