|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 3732 |
Name | CD82 |
Synonym | 4F9|C33|GR15|IA4|KAI1|R2|SAR2|ST6|TSPAN27;CD82 molecule;CD82;CD82 molecule |
Definition | C33 antigen|CD82 antigen|inducible membrane protein R2|kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4))|metastasis suppressor Kangai-1|tetraspanin-27|tspan-27 |
Position | 11p11.2 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status |
Description |
reviewed | "tumor suppressor KAI1 affects integrin alphavbeta3-mediated ovarian cancer cell adhesion, motility, and proliferation." |
reviewed | KAI1 is a tumor metastasis suppressor gene in digestive tract carcinomas and cancer cells. |
More detail of all 2 literatures about CD82 | |
Pathways and Diseases |
|
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
Disease | Cancer;FunDO |
Disease | Prostate cancer, susceptibility to;OMIM |
Disease | Penile disease;FunDO |
External Links |
|
Links to Entrez Gene | 3732 |
Links to all GeneRIF Items | 3732 |
Links to iHOP | 3732 |
Sequence Information |
|
Nucleotide Sequence |
>3732 : length: 729 atgggctcagcctgtatcaaagtcaccaaatactttctcttcctcttcaacttgatcttc tttatcctgggcgcagtgatcctgggcttcggggtgtggatcctggccgacaagagcagt ttcatctctgtcctgcaaacctcctccagctcgcttaggatgggggcctatgtcttcatc ggcgtgggggcagtcactatgctcatgggcttcctgggctgcatcggcgccgtcaacgag gtccgctgcctgctggggctgctgaagcaggagatgggcggcatcgtgactgagctcatt cgagactacaacagcagtcgcgaggacagcctgcaggatgcctgggactacgtgcaggct caggtgaagtgctgcggctgggtcagcttctacaactggacagacaacgctgagctcatg aatcgccctgaggtcacctacccctgttcctgcgaagtcaagggggaagaggacaacagc ctttctgtgaggaagggcttctgcgaggcccccggcaacaggacccagagtggcaaccac cctgaggactggcctgtgtaccaggagggctgcatggagaaggtgcaggcgtggctgcag gagaacctgggcatcatcctcggcgtgggcgtgggtgtggccatcatcgagctcctgggg atggtcctgtccatctgcttgtgccggcacgtccattccgaagactacagcaaggtcccc aagtactga |
Protein Sequence |
>3732 : length: 242 MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI GVGAVTMLMGFLGCIGAVNEVRCLLGLLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQA QVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNH PEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVP KY |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |