|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 375 |
Name | ARF1 |
Synonym | -;ADP-ribosylation factor 1;ARF1;ADP-ribosylation factor 1 |
Definition | - |
Position | 1q42 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Overexpression of SPN causes activation of the tumor suppressor protein ARF1. |
reviewed | human ARF tumor suppressor binds to Tat-binding protein-1 and has a role in control of cell proliferation. |
reviewed | "tumor suppressor ARF degrades B23, a nucleolar protein involved in ribosome biogenesis and cell proliferation." |
reviewed | Loss of the ARF tumor suppressor reverses premature replicative arrest but not radiation hypersensitivity arising from disabled atm function. |
| More detail of all 4 literatures about ARF1 | |
|
Pathways and Diseases |
|
Pathway | Golgi Associated Vesicle Biogenesis;PID Reactome;500014 |
Pathway | Clathrin derived vesicle budding;PID Reactome;500013 |
Pathway | Lysosome Vesicle Biogenesis;PID Reactome;500015 |
Pathway | COPI Mediated Transport;PID Reactome;500011 |
Pathway | Vibrio cholerae infection;KEGG PATHWAY;hsa05110 |
Pathway | phosphoinositides and their downstream targets;PID BioCarta;100059 |
Pathway | Membrane Trafficking;Reactome;REACT:11123 |
Pathway | Nef Mediated CD4 Down-regulation;PID Reactome;500759 |
Pathway | adp-ribosylation factor;PID BioCarta;100239 |
Pathway | Integrin signalling pathway;PANTHER;P00034 |
Pathway | Huntington disease;PANTHER;P00029 |
Pathway | HIV Infection;Reactome;REACT:6185 |
Pathway | Arf1 pathway;PID Curated;200167 |
Pathway | Class I PI3K signaling events;PID Curated;200098 |
Pathway | Arf6 downstream pathway;PID Curated;200079 |
|
External Links |
|
Links to Entrez Gene | 375 |
Links to all GeneRIF Items | 375 |
Links to iHOP | 375 |
|
Sequence Information |
|
Nucleotide Sequence |
>375 : length: 546 atggggaacatcttcgccaacctcttcaagggcctttttggcaaaaaagaaatgcgcatc ctcatggtgggcctggatgctgcagggaagaccacgatcctctacaagcttaagctgggt gagatcgtgaccaccattcccaccataggcttcaacgtggaaaccgtggagtacaagaac atcagcttcactgtgtgggacgtgggtggccaggacaagatccggcccctgtggcgccac tacttccagaacacacaaggcctgatcttcgtggtggacagcaatgacagagagcgtgtg aacgaggcccgtgaggagctcatgaggatgctggccgaggacgagctccgggatgctgtc ctcctggtgttcgccaacaagcaggacctccccaacgccatgaatgcggccgagatcaca gacaagctggggctgcactcactacgccacaggaactggtacattcaggccacctgcgcc accagcggcgacgggctctatgaaggactggactggctgtccaatcagctccggaaccag aagtga |
Protein Sequence |
>375 : length: 181 MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K |