|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 3814 |
Name | KISS1 |
Synonym | KiSS-1;KiSS-1 metastasis-suppressor;KISS1;KiSS-1 metastasis-suppressor |
Definition | kisspeptin|kisspeptin-1|malignant melanoma metastasis-suppressor|metastasis-suppressor KiSS-1|metastin |
Position | 1q32 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | tumor suppressor role of KiSS-1 in bladder cancer: loss of KiSS-1 expression is associated with bladder cancer progression and clinical outcome. |
| More detail of all 1 literatures about KISS1 | |
|
Pathways and Diseases |
|
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Peptide ligand-binding receptors;PID Reactome;500405 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 3814 |
Links to all GeneRIF Items | 3814 |
Links to iHOP | 3814 |
|
Sequence Information |
|
Nucleotide Sequence |
>3814 : length: 417 atgaactcactggtttcttggcagctactgcttttcctctgtgccacccactttggggag ccattagaaaaggtggcctctgtggggaattctagacccacaggccagcagctagaatcc ctgggcctcctggcccccggggagcagagcctgccgtgcaccgagaggaagccagctgct actgccaggctgagccgtcgggggacctcgctgtccccgccccccgagagctccgggagc ccccagcagccgggcctgtccgccccccacagccgccagatccccgcaccccagggcgcg gtgctggtgcagcgggagaaggacctgccgaactacaactggaactccttcggcctgcgc ttcggcaagcgggaggcggcaccagggaaccacggcagaagcgctgggcggggctga |
Protein Sequence |
>3814 : length: 138 MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAA TARLSRRGTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLR FGKREAAPGNHGRSAGRG |