|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 387496 |
Name | RASL11A |
Synonym | -;RAS-like, family 11, member A;RASL11A;RAS-like, family 11, member A |
Definition | ras-like protein family member 11A |
Position | 13q12.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | RASL11A is down-regulated in prostate tumors as measured by quantitative real-time PCR. This result suggests that this gene may have a tumor suppressor role in prostate cancer. |
More detail of all 1 literatures about RASL11A | |
External Links |
|
Links to Entrez Gene | 387496 |
Links to all GeneRIF Items | 387496 |
Links to iHOP | 387496 |
Sequence Information |
|
Nucleotide Sequence |
>387496 : length: 729 atgcggccgctcagcatgtccgggcactttctgctcgcacccatccccgagtcctcctcg gactacctactgcccaaggacatcaaactggcggtgctgggcgccggccgcgtgggcaag agcgcaatgatcgtgcgcttcctgaccaagagattcattggagactatgaaccgaataca ggcaagctgtattcacggctggtctatgtcgagggggaccagctctccctgcagatccag gatactcccgggggcgtccagatccaagacagcctcccccaggtcgtcgattccctgtcc aaatgcgtgcagtgggccgagggttttctgctggtctattccatcacagactatgacagc tacttgtccatccgacccctttatcagcacatccggaaggtccaccctgactctaaagcc cctgtcatcatcgtgggcaacaagggggaccttttgcatgcccggcaggtgcagacacag gacggtattcagctagccaatgagctgggcagcctgttccttgaaatttccactagcgaa aactacgaagatgtctgtgatgtgtttcagcatctctgcaaagaagtgagcaagatgcac ggcctcagtggggaaagaagaagagcctccatcatccctcggccccgctctcccaacatg caggacctgaagagacgcttcaagcaggctctgtctcccaaagtcaaagccccctctgca ctggggtga |
Protein Sequence |
>387496 : length: 242 MRPLSMSGHFLLAPIPESSSDYLLPKDIKLAVLGAGRVGKSAMIVRFLTKRFIGDYEPNT GKLYSRLVYVEGDQLSLQIQDTPGGVQIQDSLPQVVDSLSKCVQWAEGFLLVYSITDYDS YLSIRPLYQHIRKVHPDSKAPVIIVGNKGDLLHARQVQTQDGIQLANELGSLFLEISTSE NYEDVCDVFQHLCKEVSKMHGLSGERRRASIIPRPRSPNMQDLKRRFKQALSPKVKAPSA LG |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |