|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 390 |
Name | RND3 |
Synonym | ARHE|Rho8|RhoE|memB;Rho family GTPase 3;RND3;Rho family GTPase 3 |
Definition | protein MemB|ras homolog gene family, member E|rho-related GTP-binding protein Rho8|rho-related GTP-binding protein RhoE|small GTP binding protein Rho8 |
Position | 2q23.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | RhoE is a tumor suppressor gene that is downregulated early in the development of prostate cancer. |
More detail of all 1 literatures about RND3 | |
Pathways and Diseases |
|
Pathway | Integrin signalling pathway;PANTHER;P00034 |
Disease | Prostate cancer;FunDO |
External Links |
|
Links to Entrez Gene | 390 |
Links to all GeneRIF Items | 390 |
Links to iHOP | 390 |
Sequence Information |
|
Nucleotide Sequence |
>390 : length: 735 atgaaggagagaagagccagccagaaattatccagcaaatctatcatggatcctaatcag aacgtgaaatgcaagatagttgtggtgggagacagtcagtgtggaaaaactgcgctgctc catgtcttcgccaaggactgcttccccgagaattacgttcctacagtgtttgagaattac acggccagttttgaaatcgacacacaaagaatagagttgagcctgtgggacacttcgggt tctccttactatgacaatgtccgccccctctcttaccctgattcggatgctgtgctgatt tgctttgacatcagtagaccagagaccctggacagtgtcctcaaaaagtggaaaggtgaa atccaggaattttgtccaaataccaaaatgctcttggtcggctgcaagtctgatctgcgg acagatgttagtacattagtagagctctccaatcacaggcagacgccagtgtcctatgac cagggggcaaatatggccaaacagattggagcagctacttatatcgaatgctcagcttta cagtcggaaaatagcgtcagagacatttttcacgttgccaccttggcatgtgtaaataag acaaataaaaacgttaagcggaacaaatcacagagagccacaaagcggatttcacacatg cctagcagaccagaactctcggcagttgctacggacttacgaaaggacaaagcgaagagc tgcactgtgatgtga |
Protein Sequence |
>390 : length: 244 MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENY TASFEIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGE IQEFCPNTKMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSAL QSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKS CTVM |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |