|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 400410 |
Name | ST20 |
Synonym | HCCS-1;suppressor of tumorigenicity 20;ST20;suppressor of tumorigenicity 20 |
Definition | cervical cancer suppressor-1|human cervical cancer suppressor gene 1 protein|suppressor of tumorigenicity 20 protein |
Position | 15q25.1 |
Gene Type | protein-coding |
Source | Count: 2; Generif,UniProt |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Candidate tumor suppressor, HCCS-1, is downregulated in human cancers and induces apoptosis in cervical cancer." |
| More detail of all 1 literatures about ST20 | |
|
External Links |
|
Links to Entrez Gene | 400410 |
Links to all GeneRIF Items | 400410 |
Links to iHOP | 400410 |
|
Sequence Information |
|
Nucleotide Sequence |
>400410 : length: 240 atggcgcgatctcggctcactgcaacctctgtctcccaggttcaggaaaatggctttgta aagaagcttgagcctaaatctggctggatgacttttctagaagttacaggaaagatctgt gaaatgctcttctgtcctgaagcaatactgttgaccagaaaggacactccatattgtgaa accggcctaatttttctgactcttacgaaaacgattgccaacacatacttctacttttaa |
Protein Sequence |
>400410 : length: 79 MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCE TGLIFLTLTKTIANTYFYF |