|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4015 |
Name | LOX |
Synonym | -;lysyl oxidase;LOX;lysyl oxidase |
Definition | protein-lysine 6-oxidase |
Position | 5q23.2 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | the interaction of LOX-PP with Hsp70 and c-Raf inhibits a critical intermediate in Ras-induced MEK signaling and plays an important role in the function of this tumor suppressor. |
reviewed | Genetic polymorphism as a mechanism of impaired tumor suppressor function of LOX-propeptide and it may play an etiologic role in ER-negative breast cancer. |
reviewed | BCL2 repression by the tumor suppressor activity of the lysyl oxidase propeptide inhibits transformed phenotype of lung and pancreatic cancer cells. |
reviewed | "LOX is a tumor suppressor gene inactivated by methylation and loss of heterozygosity in gastric cancers, and possibly also in other cancers." |
reviewed | Demonstration of in vitro interaction between tumor suppressor lysyl oxidase and histones H1 and H2: definition of the regions involved. |
| More detail of all 5 literatures about LOX | |
|
External Links |
|
Links to Entrez Gene | 4015 |
Links to all GeneRIF Items | 4015 |
Links to iHOP | 4015 |
|
Sequence Information |
|
Nucleotide Sequence |
>4015 : length: 564 atgtccatgtacaacctgagatgcgcggcggaggaaaactgtctggccagtacagcatac agggcagatgtcagagattatgatcacagggtgctgctcagatttccccaaagagtgaaa aaccaagggacatcagatttcttacccagccgaccaagatattcctgggaatggcacagt tgtcatcaacattaccacagtatggatgagtttagccactatgacctgcttgatgccaac acccagaggagagtggctgaaggccacaaagcaagtttctgtcttgaagacacatcctgt gactatggctaccacaggcgatttgcatgtactgcacacacacagggattgagtcctggc tgttatgatacctatggtgcagacatagactgccagtggattgatattacagatgtaaaa cctggaaactatatcctaaaggtcagtgtaaaccccagctacctggttcctgaatctgac tataccaacaatgttgtgcgctgtgacattcgctacacaggacatcatgcgtatgcctca ggctgcacaatttcaccgtattag |
Protein Sequence |
>4015 : length: 187 MSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHS CHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYAS GCTISPY |