|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 429 |
Name | ASCL1 |
Synonym | ASH1|HASH1|MASH1|bHLHa46;achaete-scute complex homolog 1 (Drosophila);ASCL1;achaete-scute complex homolog 1 (Drosophila) |
Definition | ASH-1|achaete scute protein|achaete-scute complex-like 1|achaete-scute homolog 1|class A basic helix-loop-helix protein 46 |
Position | 12q23.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | ASH1 functions as a dual transcription factor by activating neuroendocrine differentiation markers and also repressing putative tumor suppressors. |
| More detail of all 1 literatures about ASCL1 | |
|
Pathways and Diseases |
|
Pathway | Notch-mediated HES/HEY network;PID Curated;200196 |
Disease | Central hypoventilation syndrome, congenital;OMIM |
Disease | Cancer;FunDO |
Disease | Haddad syndrome;OMIM |
Disease | Brain disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 429 |
Links to all GeneRIF Items | 429 |
Links to iHOP | 429 |
|
Sequence Information |
|
Nucleotide Sequence |
>429 : length: 711 atggaaagctctgccaagatggagagcggcggcgccggccagcagccccagccgcagccc cagcagcccttcctgccgcccgcagcctgtttctttgccacggccgcagccgcggcggcc gcagccgccgcagcggcagcgcagagcgcgcagcagcagcagcagcagcagcagcagcag cagcaggcgccgcagctgagaccggcggccgacggccagccctcagggggcggtcacaag tcagcgcccaagcaagtcaagcgacagcgctcgtcttcgcccgaactgatgcgctgcaaa cgccggctcaacttcagcggctttggctacagcctgccgcagcagcagccggccgccgtg gcgcgccgcaacgagcgcgagcgcaaccgcgtcaagttggtcaacctgggctttgccacc cttcgggagcacgtccccaacggcgcggccaacaagaagatgagtaaggtggagacactg cgctcggcggtcgagtacatccgcgcgctgcagcagctgctggacgagcatgacgcggtg agcgccgccttccaggcaggcgtcctgtcgcccaccatctcccccaactactccaacgac ttgaactccatggccggctcgccggtctcatcctactcgtcggacgagggctcttacgac ccgctcagccccgaggagcaggagcttctcgacttcaccaactggttctga |
Protein Sequence |
>429 : length: 236 MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |