|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4477 |
Name | MSMB |
Synonym | HPC13|IGBF|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94;microseminoprotein, beta-;MSMB;microseminoprotein, beta- |
Definition | beta-microseminoprotein|immunoglobulin binding factor|prostate secreted seminal plasma protein|prostate secretory protein of 94 amino acids|seminal plasma beta-inhibin |
Position | 10q11.2 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Our data disclose a hitherto unexplored link between the putative oncogene EZH2 and the tumor suppressor PSP94, and show that MSMB is silenced by EZH2 in advanced prostate cancer cells." |
| More detail of all 1 literatures about MSMB | |
|
External Links |
|
Links to Entrez Gene | 4477 |
Links to all GeneRIF Items | 4477 |
Links to iHOP | 4477 |
|
Sequence Information |
|
Nucleotide Sequence |
>4477 : length: 345 atgaatgttctcctgggcagcgttgtgatctttgccaccttcgtgactttatgcaatgca tcatgctatttcatacctaatgagggagttccaggagattcaaccaggaaatgcatggat ctcaaaggaaacaaacacccaataaactcggagtggcagactgacaactgtgagacatgc acttgctacgaaacagaaatttcatgttgcacccttgtttctacacctgtgggttatgac aaagacaactgccaaagaatcttcaagaaggaggactgcaagtatatcgtggtggagaag aaggacccaaaaaagacctgttctgtcagtgaatggataatctaa |
Protein Sequence |
>4477 : length: 114 MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETC TCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |