|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 4507 |
Name | MTAP |
Synonym | MSAP|c86fus;methylthioadenosine phosphorylase;MTAP;methylthioadenosine phosphorylase |
Definition | 5'-methylthioadenosine phosphorylase|MTA phosphorylase|MTAPase|MeSAdo phosphorylase|S-methyl-5'-thioadenosine phosphorylase |
Position | 9p21 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status |
Description |
reviewed | Construction of a 2.8-megabase yeast artificial chromosome contig and cloning of the human methylthioadenosine phosphorylase gene from the tumor suppressor region on 9p21. |
potential | "Methylthioadenosine phosphorylase, a gene frequently codeleted with p16(cdkN2a/ARF), acts as a tumor suppressor in a breast cancer cell line." |
More detail of all 2 literatures about MTAP | |
Pathways and Diseases |
|
Pathway | Cysteine and methionine metabolism;KEGG PATHWAY;hsa00270 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Disease | hypertension;GAD |
Disease | Cutaneous nevi;GAD |
Disease | Cutaneous nevi;NHGRI |
Disease | CARDIOVASCULAR;GAD |
Disease | Brain Ischemia;GAD |
Disease | Hyperlipidemias;GAD |
Disease | Diabetes Mellitus;GAD |
Disease | Cancer;FunDO |
Disease | Intracranial Embolism;GAD |
External Links |
|
Links to Entrez Gene | 4507 |
Links to all GeneRIF Items | 4507 |
Links to iHOP | 4507 |
Sequence Information |
|
Nucleotide Sequence |
>4507 : length: 852 atggcctctggcaccaccaccaccgccgtgaagattggaataattggtggaacaggcctg gatgatccagaaattttagaaggaagaactgaaaaatatgtggatactccatttggcaag ccatctgatgccttaattttggggaagataaaaaatgttgattgcgtcctccttgcaagg catggaaggcagcacaccatcatgccttcaaaggtcaactaccaggcgaacatctgggct ttgaaggaagagggctgtacacatgtcatagtgaccacagcttgtggctccttgagggag gagattcagcccggcgatattgtcattattgatcagttcattgacaggaccactatgaga cctcagtccttctatgatggaagtcattcttgtgccagaggagtgtgccatattccaatg gctgagccgttttgccccaaaacgagagaggttcttatagagactgctaagaagctagga ctccggtgccactcaaaggggacaatggtcacaatcgagggacctcgttttagctcccgg gcagaaagcttcatgttccgcacctggggggcggatgttatcaacatgaccacagttcca gaggtggttcttgctaaggaggctggaatttgttacgcaagtatcgccatggcgacagat tatgactgctggaaggagcacgaggaagcagtttcggtggaccgggtcttaaagaccctg aaagaaaacgctaataaagccaaaagcttactgctcactaccatacctcagatagggtcc acagaatggtcagaaaccctccataacctgaagaatatggcccagttttctgttttatta ccaagacattaa |
Protein Sequence |
>4507 : length: 283 MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLAR HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMR PQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSR AESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTL KENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |