|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4601 |
Name | MXI1 |
Synonym | MAD2|MXD2|MXI|bHLHc11;MAX interactor 1;MXI1;MAX interactor 1 |
Definition | MAX dimerization protein 2|Max-related transcription factor|class C basic helix-loop-helix protein 11|max-interacting protein 1 |
Position | 10q24-q25 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Genomic organization of human MXI1, a putative tumor suppressor gene." |
reviewed | Identification and analysis of tumor suppressor loci at chromosome 10q23.3-10q25.3 in medulloblastoma. |
potential | Data show that PTEN and MXI1 were two candidate tumor suppressor genes on 10q23 and 10q24-q25 and may be potentially involved in the initiation and progression of prostate carcinoma. |
potential | These findings support MXI1 as a putative tumor suppressor gene involved in conventional melanoma progression. |
| More detail of all 4 literatures about MXI1 | |
|
External Links |
|
Links to Entrez Gene | 4601 |
Links to all GeneRIF Items | 4601 |
Links to iHOP | 4601 |
|
Sequence Information |
|
Nucleotide Sequence |
>4601 : length: 549 atgccgagcccccgactgcagcattcaaagcccccacggaggttgagccgggcacagaaa cacagcagcgggagcagcaacaccagcactgccaacagacgagctcatctgcgcctttgt ttagaacgcttaaaagttctgattccactaggaccagactgcacccggcacacaacactt ggtttgctcaacaaagccaaagcacacatcaagaaacttgaagaagctgaaagaaaaagc cagcaccagctcgagaatttggaacgagaacagagatttttaaagtggcgactggaacag ctgcagggtcctcaggagatggaacgaatacgaatggacagcattggatcaactatttct tcagatcgttctgattcagagcgagaggagattgaagtggatgttgaaagcacagagttc tcccatggagaagtggacaatataagtaccaccagcatcagtgacattgatgaccacagc agcctgccgagtattgggagtgacgagggttactccagtgccagtgtcaaactttcattc acttcatag |
Protein Sequence |
>4601 : length: 182 MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTL GLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTIS SDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSF TS |