|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 4681 |
Name | NBL1 |
Synonym | D1S1733E|DAN|DAND1|NB|NO3;neuroblastoma, suppression of tumorigenicity 1;NBL1;neuroblastoma, suppression of tumorigenicity 1 |
Definition | DAN domain family member 1|differential screening-selected gene aberrant in neuroblastoma|neuroblastoma candidate region, suppression of tumorigenicity 1|neuroblastoma suppressor of tumorigenicity 1 |
Position | 1p36.13 |
Gene Type | protein-coding |
Source | Count: 2; TAG,UniProt |
Literature support | Count: 0 PubMed records as below. |
Evidence Status |
Description |
| . |
More detail of all 0 literatures about NBL1 | |
External Links |
|
Links to Entrez Gene | 4681 |
Links to all GeneRIF Items | 4681 |
Links to iHOP | 4681 |
Sequence Information |
|
Nucleotide Sequence |
>4681 : length: 546 atgatgcttcgggtcctggtgggggctgtcctccctgccatgctactggctgccccacca cccatcaacaagctggcactgttcccagataagagtgcctggtgcgaagccaagaacatc acccagatcgtgggccacagcggctgtgaggccaagtccatccagaacagggcgtgccta ggacagtgcttcagctacagcgtccccaacaccttcccacagtccacagagtccctggtt cactgtgactcctgcatgccagcccagtccatgtgggagattgtgacgctggagtgcccg ggccacgaggaggtgcccagggtggacaagctggtggagaagatcctgcactgtagctgc caggcctgcggcaaggagcctagtcacgaggggctgagcgtctatgtgcagggcgaggac gggccgggatcccagcccggcacccaccctcacccccatccccacccccatcctggcggg cagacccctgagcccgaggacccccctggggccccccacacagaggaagagggggctgag gactga |
Protein Sequence |
>4681 : length: 181 MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACL GQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSC QACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE D |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |