|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 4804 |
Name | NGFR |
Synonym | CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR;nerve growth factor receptor;NGFR;nerve growth factor receptor |
Definition | NGF receptor|TNFR superfamily, member 16|low affinity nerve growth factor receptor|low affinity neurotrophin receptor p75NTR|low-affinity nerve growth factor receptor|p75 ICD|tumor necrosis factor receptor superfamily member 16 |
Position | 17q21-q22 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
Evidence Status | Description |
potential | we provided the evidence that p75NTR was a potential tumor suppressor. |
reviewed | The p75 NTR neurotrophin receptor is a tumor suppressor in human and murine retinoblastoma development. |
reviewed | The p75(NTR) tumor suppressor induces cell cycle arrest facilitating caspase mediated apoptosis in prostate tumor cells. |
reviewed | p75(NTR) tumor suppressor induces caspase-mediated apoptosis in bladder tumor cells. |
| More detail of all 4 literatures about NGFR | |
Pathways and Diseases | |
Pathway | p75NTR negatively regulates cell cycle via SC1;PID Reactome;500612 |
Pathway | nerve growth factor pathway (ngf);PID BioCarta;100096 |
Pathway | NRAGE signals death through JNK;PID Reactome;500609 |
Pathway | p75(NTR)-mediated signaling;PID Curated;200103 |
Pathway | Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722 |
Pathway | Ceramide signalling;PID Reactome;500616 |
Pathway | p75 NTR receptor-mediated signalling;PID Reactome;500606 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | NFG and proNGF binds to p75NTR;PID Reactome;500607 |
Pathway | Axonal growth inhibition (RHOA activation);PID Reactome;500619 |
Pathway | Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128 |
Pathway | NRIF signals cell death from the nucleus;PID Reactome;500610 |
Pathway | Axonal growth stimulation;PID Reactome;500618 |
Pathway | phosphorylation of mek1 by cdk5/p35 down regulates the map kinase pathway;PID BioCarta;100210 |
Pathway | Signalling by NGF;Reactome;REACT:11061 |
Pathway | p75NTR recruits signalling complexes;PID Reactome;500614 |
Pathway | erk1/erk2 mapk signaling pathway;PID BioCarta;100170 |
Pathway | Cell death signalling via NRAGE, NRIF and NADE;PID Reactome;500608 |
Pathway | p75NTR regulates axonogenesis;PID Reactome;500617 |
Pathway | NADE modulates death signalling;PID Reactome;500611 |
Pathway | Regulated proteolysis of p75NTR;PID Reactome;500620 |
Disease | suicide;GAD |
Disease | PSYCH;GAD |
Disease | depressive disorder, major;GAD |
External Links | |
Links to Entrez Gene | 4804 |
Links to all GeneRIF Items | 4804 |
Links to iHOP | 4804 |
Sequence Information | |
Nucleotide Sequence | >4804 : length: 1284 atgggggcaggtgccaccggccgcgccatggacgggccgcgcctgctgctgttgctgctt ctgggggtgtcccttggaggtgccaaggaggcatgccccacaggcctgtacacacacagc ggtgagtgctgcaaagcctgcaacctgggcgagggtgtggcccagccttgtggagccaac cagaccgtgtgtgagccctgcctggacagcgtgacgttctccgacgtggtgagcgcgacc gagccgtgcaagccgtgcaccgagtgcgtggggctccagagcatgtcggcgccgtgcgtg gaggccgacgacgccgtgtgccgctgcgcctacggctactaccaggatgagacgactggg cgctgcgaggcgtgccgcgtgtgcgaggcgggctcgggcctcgtgttctcctgccaggac aagcagaacaccgtgtgcgaggagtgccccgacggcacgtattccgacgaggccaaccac gtggacccgtgcctgccctgcaccgtgtgcgaggacaccgagcgccagctccgcgagtgc acacgctgggccgacgccgagtgcgaggagatccctggccgttggattacacggtccaca cccccagagggctcggacagcacagcccccagcacccaggagcctgaggcacctccagaa caagacctcatagccagcacggtggcaggtgtggtgaccacagtgatgggcagctcccag cccgtggtgacccgaggcaccaccgacaacctcatccctgtctattgctccatcctggct gctgtggttgtgggccttgtggcctacatagccttcaagaggtggaacagctgcaagcag aacaagcaaggagccaacagccggccagtgaaccagacgcccccaccagagggagaaaaa ctccacagcgacagtggcatctccgtggacagccagagcctgcatgaccagcagccccac acgcagacagcctcgggccaggccctcaagggtgacggaggcctctacagcagcctgccc ccagccaagcgggaggaggtggagaagcttctcaacggctctgcgggggacacctggcgg cacctggcgggcgagctgggctaccagcccgagcacatagactcctttacccatgaggcc tgccccgttcgcgccctgcttgcaagctgggccacccaggacagcgccacactggacgcc ctcctggccgccctgcgccgcatccagcgagccgacctcgtggagagtctgtgcagtgag tccactgccacatccccggtgtga |
Protein Sequence | >4804 : length: 427 MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE STATSPV |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |