|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 4824 |
Name | NKX3-1 |
Synonym | BAPX2|NKX3|NKX3.1|NKX3A;NK3 homeobox 1;NKX3-1;NK3 homeobox 1 |
Definition | NK homeobox, family 3, A|NK3 transcription factor homolog A|NK3 transcription factor related, locus 1|homeobox protein NK-3 homolog A|homeobox protein Nkx-3.1 |
Position | 8p21.2 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The prostate-specific tumor suppressor gene Nkx3.1 was controlled by ERG and ESE3 both directly and through induction of EZH2. |
reviewed | cellular levels of the NKX3.1 tumor suppressor are affected by inflammatory cytokines that target COOH-terminal serine residues to activate ubiquitination and protein degradation. |
reviewed | Ubiquitination by TOPORS regulates the prostate tumor suppressor NKX3.1. |
reviewed | NKX3.1 does not function as a typical tumor suppressor protein in prostate cancer but it may still have important regulatory roles during prostate cancer progression. |
| More detail of all 4 literatures about NKX3-1 | |
|
Pathways and Diseases |
|
Pathway | Coregulation of Androgen receptor activity;PID Curated;200038 |
Pathway | FOXA1 transcription factor network;PID Curated;200194 |
Pathway | Prostate cancer;KEGG PATHWAY;hsa05215 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Disease | Cancers;KEGG DISEASE |
Disease | Cancers of the urinary system and male genital organs;KEGG DISEASE |
Disease | Prostate cancer;KEGG DISEASE;H00024 |
Disease | Prostate cancer;NHGRI |
Disease | prostate cancer;GAD |
Disease | CANCER;GAD |
|
External Links |
|
Links to Entrez Gene | 4824 |
Links to all GeneRIF Items | 4824 |
Links to iHOP | 4824 |
|
Sequence Information |
|
Nucleotide Sequence |
>4824 : length: 705 atgctcagggttccggagccgcggcccggggaggcgaaagcggagggggccgcgccgccg accccgtccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcag cggcaaggcggccgcacgagcagccagagacagcgcgacccggagccggagccagagcca gagccagagggaggacgcagccgcgccggggcgcagaacgaccagctgagcaccgggccc cgcgccgcgccggaggaggccgagacgctggcagagaccgagccagaaaggcacttgggg tcttatctgttggactctgaaaacacttcaggcgcccttccaaggcttccccaaacccct aagcagccgcagaagcgctcccgagctgccttctcccacactcaggtgatcgagttggag aggaagttcagccatcagaagtacctgtcggcccctgaacgggcccacctggccaagaac ctcaagctcacggagacccaagtgaagatatggttccagaacagacgctataagactaag cgaaagcagctctcctcggagctgggagacttggagaagcactcctctttgccggccctg aaagaggaggccttctcccgggcctccctggtctccgtgtataacagctatccttactac ccatacctgtactgcgtgggcagctggagcccagctttttggtaa |
Protein Sequence |
>4824 : length: 234 MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW |