|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 50514 |
Name | DEC1 |
Synonym | CTS9;deleted in esophageal cancer 1;DEC1;deleted in esophageal cancer 1 |
Definition | candidate tumor suppressor CTS9 |
Position | 9q32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
potential | Detailed deletion mapping in squamous cell carcinomas of the esophagus narrows a region containing a putative tumor suppressor gene to about 200 kilobases on distal chromosome 9q. |
potential | "Frequent decreased expression of candidate tumor suppressor gene, DEC1, and its anchorage-independent growth properties and impact on global gene expression in esophageal carcinoma." |
potential | DEC1 is a candidate tumor suppressor gene that may be involved in esophageal squamous cell carcinoma development. |
reviewed | "Isolation and mutational analysis of a novel human cDNA, DEC1 (deleted in esophageal cancer 1), derived from the tumor suppressor locus in 9q32." |
| More detail of all 4 literatures about DEC1 | |
|
External Links |
|
Links to Entrez Gene | 50514 |
Links to all GeneRIF Items | 50514 |
Links to iHOP | 50514 |
|
Sequence Information |
|
Nucleotide Sequence |
>50514 : length: 213 atgacaatgaatgttctggaggctgggaagtggaagagcattgtgccagcacctggtgag ggccttcttgccgtgttacacatgatggtttttactgatgccctgcacagagagaggtct gtaaagtggcaagcaggagtctgctacaatggaggaaaggattttgctgtatctcttgcc aggcccaaggctgcagagggaattgcagattga |
Protein Sequence |
>50514 : length: 70 MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLA RPKAAEGIAD |