|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 50943 |
Name | FOXP3 |
Synonym | AIID|DIETER|IPEX|PIDX|XPID;forkhead box P3;FOXP3;forkhead box P3 |
Definition | FOXP3delta7|forkhead box protein P3|immune dysregulation, polyendocrinopathy, enteropathy, X-linked|immunodeficiency, polyendocrinopathy, enteropathy, X-linked|scurfin |
Position | Xp11.23 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
potential | "According to this review, FoxP3 is an important tumor suppressor gene in carcinomas and has putative cancer suppressor gene function in cutaneous melanoma as well." |
reviewed | Identification of a tumor suppressor relay between the FOXP3 and the Hippo pathways in breast and prostate cancers. |
reviewed | FOXP3 as an X-linked tumor suppressor. |
reviewed | "FOXP3 is an X-linked prostate tumor suppressor in the male. Because the male has only one X chromosome, our data represent a paradigm of ""single genetic hit"" inactivation-mediated carcinogenesis." |
| More detail of all 4 literatures about FOXP3 | |
|
Pathways and Diseases |
|
Pathway | IL2 signaling events mediated by STAT5;PID Curated;200158 |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039 |
Disease | Other well-defined immunodeficiency syndromes;KEGG DISEASE;H00107 |
Disease | diabetes, type 1;GAD |
Disease | IMMUNE;GAD |
Disease | Immune system diseases;KEGG DISEASE |
Disease | Immunodysregulation, polyendocrinopathy, and enteropathy, X-linked;OMIM |
Disease | Diabetes mellitus, type I, susceptibility to;OMIM |
Disease | Primary immunodeficiency;KEGG DISEASE |
|
External Links |
|
Links to Entrez Gene | 50943 |
Links to all GeneRIF Items | 50943 |
Links to iHOP | 50943 |
|
Sequence Information |
|
Nucleotide Sequence |
>50943 : length: 1191 atgcccaaccccaggcctggcaagccctcggccccttccttggcccttggcccatcccca ggagcctcgcccagctggagggctgcacccaaagcctcagacctgctgggggcccggggc ccagggggaaccttccagggccgagatcttcgaggcggggcccatgcctcctcttcttcc ttgaaccccatgccaccatcgcagctgcagctctcaacggtggatgcccacgcccggacc cctgtgctgcaggtgcaccccctggagagcccagccatgatcagcctcacaccacccacc accgccactggggtcttctccctcaaggcccggcctggcctcccacctgggatcaacgtg gccagcctggaatgggtgtccagggagccggcactgctctgcaccttcccaaatcccagt gcacccaggaaggacagcaccctttcggctgtgccccagagctcctacccactgctggca aatggtgtctgcaagtggcccggatgtgagaaggtcttcgaagagccagaggacttcctc aagcactgccaggcggaccatcttctggatgagaagggcagggcacaatgtctcctccag agagagatggtacagtctctggagcagcagctggtgctggagaaggagaagctgagtgcc atgcaggcccacctggctgggaaaatggcactgaccaaggcttcatctgtggcatcatcc gacaagggctcctgctgcatcgtagctgctggcagccaaggccctgtcgtcccagcctgg tctggcccccgggaggcccctgacagcctgtttgctgtccggaggcacctgtggggtagc catggaaacagcacattcccagagttcctccacaacatggactacttcaagttccacaac atgcgaccccctttcacctacgccacgctcatccgctgggccatcctggaggctccagag aagcagcggacactcaatgagatctaccactggttcacacgcatgtttgccttcttcaga aaccatcctgccacctggaagaacgccatccgccacaacctgagtctgcacaagtgcttt gtgcgggtggagagcgagaagggggctgtgtggaccgtggatgagctggagttccgcaag aaacggagccagaggcccagcaggtgttccaaccctacacctggcccctga |
Protein Sequence |
>50943 : length: 396 MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS LNPMPPSQLQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINV ASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFL KHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASS DKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHN MRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCF VRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP |