|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 51147 |
Name | ING4 |
Synonym | my036|p29ING4;inhibitor of growth family, member 4;ING4;inhibitor of growth family, member 4 |
Definition | brain my036 protein|candidate tumor suppressor p33 ING1 homolog|inhibitor of growth protein 4 |
Position | 12p13.31 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 12 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | These results sustain the view that ING4 is a tumor suppressor in breast cancer and suggest that ING4 deletion may contribute to the pathogenesis of HER2-positive breast cancer. |
reviewed | Functional impact of cancer-associated mutations in the tumor suppressor protein ING4. |
reviewed | A dominant mutant allele of the ING4 tumor suppressor found in human cancer cells exacerbates MYC-initiated mouse mammary tumorigenesis. |
reviewed | The dimeric structure and the bivalent recognition of H3K4me3 by the tumor suppressor ING4 suggests a mechanism for enhanced targeting of the HBO1 complex to chromatin. |
reviewed | The ING4 tumor suppressor attenuates NF-kappaB activity at the promoters of target genes. |
reviewed | The new tumor-suppressor gene inhibitor of growth family member 4 (ING4) regulates the production of proangiogenic molecules by myeloma cells and suppresses hypoxia-inducible factor-1 alpha (HIF-1alpha) activity: involvement in myeloma-induced angiogenesis. |
reviewed | data suggest that alternative splicing could modulate the activity of ING4 tumor suppressor protein. |
reviewed | ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. |
potential | Regulation of HIF by prolyl hydroxylases: recruitment of the candidate tumor suppressor protein ING4. |
reviewed | Frequent deletion and decreased mRNA expression of ING4 suggested it as a class two tumor suppressor gene and may play an important role in head and neck cancer. |
| More detail of all 12 literatures about ING4 | |
|
External Links |
|
Links to Entrez Gene | 51147 |
Links to all GeneRIF Items | 51147 |
Links to iHOP | 51147 |
|
Sequence Information |
|
Nucleotide Sequence |
>51147 : length: 750 atggctgcggggatgtatttggaacattatctggacagtattgaaaaccttccctttgaa ttacagagaaactttcagctcatgagggacctagaccaaagaacagaggacctgaaggct gaaattgacaagttggccactgagtatatgagtagtgcccgcagcctgagctccgaggaa aaattggcccttctcaaacagatccaggaagcctatggcaagtgcaaggaatttggtgac gacaaggtgcagcttgccatgcagacctatgagatggtggacaaacacattcggcggctg gacacagacctggcccgttttgaggctgatctcaaggagaaacagattgagtcaagtgac tatgacagctcttccagcaaaggcaaaaagaaaggccggactcaaaaggagaagaaagct gctcgtgctcgttccaaagggaaaaactcggatgaagaagcccccaagactgcccagaag aagttaaagctcgtgcgcacaagtcctgagtatgggatgccctcagtgacctttggcagt gtccacccctctgatgtgttggatatgcctgtggatcccaacgaacccacctattgcctt tgtcaccaggtctcctatggagagatgattggctgtgacaaccctgattgttccattgag tggttccattttgcctgtgtggggctgacaaccaagcctcgggggaaatggttttgccca cgctgctcccaagaacggaagaagaaatag |
Protein Sequence |
>51147 : length: 249 MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEE KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGS VHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP RCSQERKKK |