|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 51684 |
Name | SUFU |
Synonym | PRO1280|SUFUH|SUFUXL;suppressor of fused homolog (Drosophila);SUFU;suppressor of fused homolog (Drosophila) |
Definition | suppressor of fused homolog |
Position | 10q24.32 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,UniProt,Generif |
Literature support | Count: 5 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | human tumor suppressor SUFU has a role in Hedgehog signaling [review]. |
reviewed | "expression induced by 4-Hydroxynonenal,one of several lipid oxidation products, in human leukemia cells, HL-60; this tumor suppressor protein is a target of miR-378". |
reviewed | Hedgehog signaling promotes the degradation of tumor suppressor Sufu through the ubiquitin-proteasome pathway. |
reviewed | "These results suggest that miR-378 enhances cell survival, tumor growth, and angiogenesis through repression of the expression of two tumor suppressors, Sufu and Fus-1." |
reviewed | These data demonstrate that Sufu is essential for development and functions as a tumor suppressor. |
| More detail of all 5 literatures about SUFU | |
|
Pathways and Diseases |
|
Pathway | Hedgehog signaling pathway;PANTHER;P00025 |
Pathway | Hedgehog signaling events mediated by Gli proteins;PID Curated;200147 |
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Basal cell carcinoma;KEGG PATHWAY;hsa05217 |
Pathway | Hedgehog signaling pathway;KEGG PATHWAY;hsa04340 |
Disease | Medulloblastoma, desmoplastic;OMIM |
|
External Links |
|
Links to Entrez Gene | 51684 |
Links to all GeneRIF Items | 51684 |
Links to iHOP | 51684 |
|
Sequence Information |
|
Nucleotide Sequence |
>51684 : length: 1302 atggcggagctgcggcctagcggcgcccccggccccaccgcgcccccggcccctggcccg actgcccccccggccttcgcttcgctctttcccccgggactgcacgccatctacggagag tgccgccgcctttaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac tggttgggtggcccagaccccttggactatgttagcatgtacaggaatgtggggagccct tctgctaacatccccgagcactggcactacatcagcttcggcctgagtgatctctatggt gacaacagagtccatgagtttacaggaacagatggacctagtggttttggctttgagttg acctttcgtctgaagagagaaactggggagtctgccccaccaacatggcccgcagagtta atgcagggcttggcacgatacgtgttccagtcagagaacaccttctgcagtggggaccat gtgtcctggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgaca gaggacccacagatgcagcccgtgcagacaccctttggggtagttaccttcctccagatc gttggtgtctgcactgaagagctacactcagcccagcagtggaacgggcagggcatcctg gagctgctgcggacagtgcctattgctggcggcccctggctgataactgacatgcggagg ggagagaccatatttgagatcgatccacacctgcaagagagagttgacaaaggcatcgag acagatggctccaacctgagtggtgtcagtgccaagtgtgcctgggatgacctgagccgg ccccccgaggatgacgaggacagccggagcatctgcatcggcacacagccccggcgactc tctggcaaagacacagagcagatccgggagaccctgaggagaggactcgagatcaacagc aaacctgtccttccaccaatcaaccctcagcggcagaatggcctcgcccacgaccgggcc ccgagccgcaaagacagcctggaaagtgacagctccacggccatcattccccatgagctg attcgcacgcggcagcttgagagcgtacatctgaaattcaaccaggagtccggagccctc attcctctctgcctaaggggcaggctcctgcatggacggcactttacatataaaagtatc acaggtgacatggccatcacgtttgtctccacgggagtggaaggcgcctttgccactgag gagcatccttacgcggctcatggaccctggttacaactctga |
Protein Sequence |
>51684 : length: 433 MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY WLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR GETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL SGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRAPSRKDSLESDSSTAIIPHEL IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE EHPYAAHGPWLQL |