|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 51741 |
Name | WWOX |
Synonym | D16S432E|FOR|FRA16D|HHCMA56|PRO0128|SDR41C1|WOX1;WW domain containing oxidoreductase;WWOX;WW domain containing oxidoreductase |
Definition | WW domain-containing oxidoreductase|WW domain-containing protein WWOX|fragile site FRA16D oxidoreductase|short chain dehydrogenase/reductase family 41C, member 1 |
Position | 16q23.3-q24.1 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 24 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Frequent attenuation of the WWOX tumor suppressor in osteosarcoma is associated with increased tumorigenicity and aberrant RUNX2 expression. |
reviewed | analysis of the effect of the Wwox tumor suppressor gene in a knockout model. |
reviewed | Essential requirement for the Wwox tumor suppressor in proper steroidogenesis. |
reviewed | WWOX tumor suppressor is essential for postnatal survival and normal bone metabolism. |
reviewed | Wwox hypomorphs had an increased incidence of B-cell lymphomas supports a role of Wwox as a tumor suppressor. |
reviewed | analysis in mice shows that WWOX has a tumor suppressor function. |
potential | WWOX: a candidate tumor suppressor gene involved in multiple tumor types. |
reviewed | tumor suppressor genes FHIT and WWOX are deleted in primary effusion lymphoma (PEL) cell lines. |
reviewed | Evidences that the polymorphism Pro-282-Ala within the tumor suppressor gene WWOX is a new risk factor for differentiated thyroid carcinoma. |
reviewed | Bmi1 regulates cell fate via tumor suppressor WWOX repression in small-cell lung cancer cells. |
| More detail of all 24 literatures about WWOX | |
|
Pathways and Diseases |
|
Pathway | ErbB4 signaling events;PID Curated;200009 |
Disease | CHEMDEPENDENCY;GAD |
Disease | smoking cessation;GAD |
Disease | Cardiac structure and function;GAD |
Disease | Esophageal squamous cell carcinoma;OMIM |
Disease | CARDIOVASCULAR;GAD |
Disease | Cardiac structure and function;NHGRI |
|
External Links |
|
Links to Entrez Gene | 51741 |
Links to all GeneRIF Items | 51741 |
Links to iHOP | 51741 |
|
Sequence Information |
|
Nucleotide Sequence |
>51741 : length: 1245 atggcagcgctgcgctacgcggggctggacgacacggacagtgaggacgagctgcctccg ggctgggaggagagaaccaccaaggacggctgggtttactacgccaatcacaccgaggag aagactcagtgggaacatccaaaaactggaaaaagaaaacgagtggcaggagatttgcca tacggatgggaacaagaaactgatgagaacggacaagtgttttttgttgaccatataaat aaaagaaccacctacttggacccaagactggcgtttactgtggatgataatccgaccaag ccaaccacccggcaaagatacgacggcagcaccactgccatggaaattctccagggccgg gatttcactggcaaagtggttgtggtcactggagctaattcaggaatagggttcgaaacc gccaagtcttttgccctccatggtgcacatgtgatcttggcctgcaggaacatggcaagg gcgagtgaagcagtgtcacgcattttagaagaatggcataaagccaaggtagaagcaatg accctggacctcgctctgctccgtagcgtgcagcattttgctgaagcattcaaggccaag aatgtgcctcttcatgtgcttgtgtgcaacgcagcaacttttgctctaccctggagtctc accaaagatggcctggagaccacctttcaagtgaatcatctggggcacttctaccttgtc cagctcctccaggatgttttgtgccgctcagctcctgcccgtgtcattgtggtctcctca gagtcccatcgatttacagatattaacgactccttgggaaaactggacttcagtcgcctc tctccaacaaaaaacgactattgggcgatgctggcttataacaggtccaagctctgcaac atcctcttctccaacgagctgcaccgtcgcctctccccacgcggggtcacgtcgaacgca gtgcatcctggaaatatgatgtactccaacattcatcgcagctggtgggtgtacacactg ctgtttaccttggcgaggcctttcaccaagtccatgcaacagggagctgccaccaccgtg tactgtgctgctgtcccagaactggagggtctgggagggatgtacttcaacaactgctgc cgctgcatgccctcaccagaagctcagagcgaagagacggcccggaccctgtgggcgctc agcgagaggctgatccaagaacggcttggcagccagtccggctaa |
Protein Sequence |
>51741 : length: 414 MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLP YGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR DFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAM TLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLV QLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCN ILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTV YCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG |