|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5196 |
Name | PF4 |
Synonym | CXCL4|PF-4|SCYB4;platelet factor 4;PF4;platelet factor 4 |
Definition | C-X-C motif chemokine 4|chemokine (C-X-C motif) ligand 4|iroplact|oncostatin-A |
Position | 4q12-q21 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
potential | "a candidate tumor suppressor gene, platelet factor 4, was frequently silenced by promoter hypermethylation in MM (15 of 28) and MM cell lines (5 of 5)". |
| More detail of all 1 literatures about PF4 | |
|
Pathways and Diseases |
|
Pathway | Hemostasis;Reactome;REACT:604 |
Pathway | Signaling by GPCR;Reactome;REACT:14797 |
Pathway | Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060 |
Pathway | Chemokine signaling pathway;KEGG PATHWAY;hsa04062 |
Pathway | CXCR3-mediated signaling events;PID Curated;200150 |
Pathway | Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031 |
|
External Links |
|
Links to Entrez Gene | 5196 |
Links to all GeneRIF Items | 5196 |
Links to iHOP | 5196 |
|
Sequence Information |
|
Nucleotide Sequence |
>5196 : length: 306 atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag agttag |
Protein Sequence |
>5196 : length: 101 MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |