|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 5268 |
Name | SERPINB5 |
Synonym | PI5|maspin;serpin peptidase inhibitor, clade B (ovalbumin), member 5;SERPINB5;serpin peptidase inhibitor, clade B (ovalbumin), member 5 |
Definition | PI-5|peptidase inhibitor 5|protease inhibitor 5 (maspin)|serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 5|serpin B5 |
Position | 18q21.3 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 19 PubMed records as below. |
Evidence Status | Description |
reviewed | The tumor suppressor maspin does not undergo the stressed to relaxed transition or inhibit trypsin-like serine proteases. Evidence that maspin is not a protease inhibitory serpin. |
reviewed | Protease activated receptor-1 inhibits the Maspin tumor-suppressor gene to determine the melanoma metastatic phenotype. |
potential | The natural tumor suppressor protein maspin and potential application in non small cell lung cancer. |
reviewed | Testisin may promote carcinogenesis by inhibiting tumor suppressor activity of maspin. |
reviewed | "The integration of PTEN and p53 into a common pathway for the induction of another tumor suppressor, Maspin, constitutes a tumor suppressor network of PTEN/p53/Mapsin that is operational under limited oxygen conditions." |
reviewed | "P176S (C526T) substitution of maspin may result in a partial loss of the tumor suppressor function of this protein, contributing to decreased susceptibility to apoptosis and malignant progression". |
reviewed | Expression of the tumor suppressor gene maspin and its significance in intraductal papillary mucinous neoplasms of the pancreas. |
reviewed | [Role of the class II tumor suppressor gene maspin in thyroid carcinogenesis]. |
reviewed | the human tumor suppressor maspin has a conformational switch in the G-helix. |
reviewed | Prognostic significance of the tumor suppressor gene maspin in non-small cell lung cancer. |
| More detail of all 19 literatures about SERPINB5 | |
Pathways and Diseases | |
Pathway | ATF-2 transcription factor network;PID Curated;200116 |
Pathway | p53 pathway;PANTHER;P00059 |
Pathway | Direct p53 effectors;PID Curated;200101 |
Pathway | p53 signaling pathway;KEGG PATHWAY;hsa04115 |
External Links | |
Links to Entrez Gene | 5268 |
Links to all GeneRIF Items | 5268 |
Links to iHOP | 5268 |
Sequence Information | |
Nucleotide Sequence | >5268 : length: 1128 atggatgccctgcaactagcaaattcggcttttgccgttgatctgttcaaacaactatgt gaaaaggagccactgggcaatgtcctcttctctccaatctgtctctccacctctctgtca cttgctcaagtgggtgctaaaggtgacactgcaaatgaaattggacaggttcttcatttt gaaaatgtcaaagatgtaccctttggatttcaaacagtaacatcggatgtaaacaaactt agttccttttactcactgaaactaatcaagcggctctacgtagacaaatctctgaatctt tctacagagttcatcagctctacgaagagaccgtatgcaaaggaattggaaactgttgac ttcaaagataaattggaagaaacgaaaggtcagatcaacaactcaattaaggatctcaca gatggccactttgagaacattttagctgacaacagtgtgaacgaccagaccaaaatcctt gtggttaatgctgcctactttgttggcaagtggatgaagaaattttctgaatcagaaaca aaagaatgtcctttcagagtcaacaagacagacaccaaaccagtgcagatgatgaacatg gaggccacgttctgtatgggaaacattgacagtatcaattgtaagatcatagagcttcct tttcaaaataagcatctcagcatgttcatcctactacccaaggatgtggaggatgagtcc acaggcttggagaagattgaaaaacaactcaactcagagtcactgtcacagtggactaat cccagcaccatggccaatgccaaggtcaaactctccattccaaaatttaaggtggaaaag atgattgatcccaaggcttgtctggaaaatctagggctgaaacatatcttcagtgaagac acatctgatttctctggaatgtcagagaccaagggagtggccctatcaaatgttatccac aaagtgtgcttagaaataactgaagatggtggggattccatagaggtgccaggagcacgg atcctgcagcacaaggatgaattgaatgctgaccatccctttatttacatcatcaggcac aacaaaactcgaaacatcattttctttggcaaattctgttctccttaa |
Protein Sequence | >5268 : length: 375 MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESET KECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH NKTRNIIFFGKFCSP |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |