|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 5325 |
Name | PLAGL1 |
Synonym | LOT1|ZAC|ZAC1;pleiomorphic adenoma gene-like 1;PLAGL1;pleiomorphic adenoma gene-like 1 |
Definition | LOT-1|PLAG-like 1|ZAC tumor supressor|lost on transformation 1|pleiomorphic adenoma gene-like protein 1|pleiomorphic adenoma-like protein 1|tumor supressor ZAC|zinc finger protein PLAGL1 |
Position | 6q24-q25 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 6 PubMed records as below. |
Evidence Status |
Description |
reviewed | tumor suppressor gene ZAC/PLAGL1: altered expression and loss of the nonimprinted allele in pheochromocytomas. |
reviewed | Preferential loss of the nonimprinted allele for the ZAC1 tumor suppressor gene in human capillary hemangioblastoma. |
potential | The candidate tumor suppressor gene ZAC is involved in keratinocyte differentiation and its expression is lost in basal cell carcinomas. |
potential | "LOT1 (PLAGL1/ZAC1), the candidate tumor suppressor gene at chromosome 6q24-25, is epigenetically regulated in cancer." |
potential | Alternative splicing of the imprinted candidate tumor suppressor gene ZAC regulates its antiproliferative and DNA binding activities. |
potential | "Zac1 (Lot1), a potential tumor suppressor gene, and the gene for epsilon-sarcoglycan are maternally imprinted genes: identification by a subtractive screen of novel uniparental fibroblast lines." |
More detail of all 6 literatures about PLAGL1 | |
External Links |
|
Links to Entrez Gene | 5325 |
Links to all GeneRIF Items | 5325 |
Links to iHOP | 5325 |
Sequence Information |
|
Nucleotide Sequence |
>5325 : length: 1392 atggccacgttcccctgccagttatgtggcaagacgttcctcaccctggagaagttcacg attcacaattattcccactccagggagcggccgtacaagtgtgtgcagcctgactgtggc aaagcctttgtttccagatataaattgatgaggcatatggctacccattctccccagaaa tctcaccagtgtgctcactgtgagaagacgttcaaccggaaagaccacctgaaaaaccac ctccagacccacgaccccaacaaaatggcctttgggtgtgaggagtgtgggaagaagtac aacaccatgctgggctataagaggcacctggccctccatgcggccagcagtggggacctc acctgtggggtctgtgccctggagctagggagcaccgaggtgctactggaccacctcaaa gcccatgcggaagagaagccccctagcggaaccaaggaaaagaagcaccagtgcgaccac tgtgaaagatgcttctacacccggaaggatgtgcgacgccacctggtggtccacacagga tgcaaggacttcctgtgccagttctgtgcccagagatttgggcgcaaggatcacctcacc cggcataccaagaagacccactcacaggagctgatgaaagagagcttgcagaccggagac cttctgagcaccttccacaccatctcgccttcattccaactgaaggctgctgccttgcct cctttccctttaggagcttctgcccagaacgggcttgcaagtagcttgccagctgaggtc catagcctcaccctcagtcccccagaacaagccgcccagcctatgcagccgctgccagag tccctggcctccctccacccctcggtatcccctggctctcctccgccaccccttcccaat cacaagtacaacaccacttctacctcatactccccacttgcaagcctgcccctcaaagca gatactaaaggtttttgcaatatcagtttgtttgaggacttgcctctgcaagagcctcag tcacctcaaaagctcaacccaggttttgatctggctaagggaaatgctggtaaagtaaac ctgcccaaggagctgcctgcagatgctgtgaacctaacaatacctgcctctctggacctg tcccccctgttgggcttctggcagctgccccctcctgctacccaaaatacctttgggaat agcactcttgccctggggcctggggaatctttgccccacaggttaagctgtctggggcag cagcagcaagaacccccacttgccatgggcactgtgagcctgggccagctccccctgccc cccatccctcatgtgttctcagctggcactggctctgccatcctgcctcatttccatcat gcattcagataa |
Protein Sequence |
>5325 : length: 463 MATFPCQLCGKTFLTLEKFTIHNYSHSRERPYKCVQPDCGKAFVSRYKLMRHMATHSPQK SHQCAHCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL TCGVCALELGSTEVLLDHLKAHAEEKPPSGTKEKKHQCDHCERCFYTRKDVRRHLVVHTG CKDFLCQFCAQRFGRKDHLTRHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALP PFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPN HKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVN LPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQ QQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |