|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 54556 |
Name | ING3 |
Synonym | Eaf4|ING2|MEAF4|p47ING3;inhibitor of growth family, member 3;ING3;inhibitor of growth family, member 3 |
Definition | inhibitor of growth protein 3 |
Position | 7q31 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
Evidence Status |
Description |
reviewed | The tumor suppressor ING3 is degraded by SCF(Skp2)-mediated ubiquitin-proteasome system. |
potential | ING3 would function as a potential tumor suppressor molecule and that low levels of ING3 may indicate an aggressive nature of head and neck cancer. |
reviewed | ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. |
potential | "Allelic loss and reduced expression of the ING3, a candidate tumor suppressor gene at 7q31, in human head and neck cancers." |
More detail of all 4 literatures about ING3 | |
External Links |
|
Links to Entrez Gene | 54556 |
Links to all GeneRIF Items | 54556 |
Links to iHOP | 54556 |
Sequence Information |
|
Nucleotide Sequence |
>54556 : length: 1257 atgttgtacctagaagactatctggaaatgattgagcagcttcctatggatctgcgggac cgcttcacggaaatgcgcgagatggacctgcaggtgcagaatgcaatggatcaactagaa caaagagtcagtgaattctttatgaatgcaaagaaaaataaacctgagtggagggaagag caaatggcatccatcaaaaaagactactataaagctttggaagatgcagatgagaaggtt cagttggcaaaccagatatatgacttggtagatcgacacttgagaaagctggatcaggaa ctggctaagtttaaaatggagctggaagctgataatgctggaattacagaaatattagag aggcgatctttggaattagacactccttcacagccagtgaacaatcaccatgctcattca catactccagtggaaaaaaggaaatataatccaacttctcaccatacgacaacagatcat attcctgaaaagaaatttaaatctgaagctcttctatccacccttacgtcagatgcctct aaggaaaatacactaggttgtcgaaataataattccacagcctcttctaacaatgcctac aatgtgaattcctcccaacctctgggatcctataacattggctcgttatcttcaggaact ggtgcaggggcaattaccatggcagctgctcaagcagttcaggctacagctcagatgaag gagggacgaagaacatcaagtttaaaagccagttatgaagcatttaagaataatgacttt cagttgggaaaagaattttcaatggccagggaaacagttggctattcatcatcttcggca cttatgacaacattaacacagaatgccagttcatcagcagccgactcacggagtggtcga aagagcaaaaacaacaacaagtcttcaagccagcagtcatcatcttcctcctcctcttct tccttatcatcgtgttcttcatcatcaactgttgtacaagaaatctctcaacaaacaact gtagtgccagaatctgattcaaatagtcaggttgattggacttacgacccaaatgaacct cgatactgcatttgtaatcaggtatcttatggtgagatggtgggatgtgataaccaagat tgccctatagaatggttccattatggctgcgttggattgacagaggcaccaaaaggcaaa tggtactgtccacagtgcactgctgcaatgaagagaagaggcagcagacacaaataa |
Protein Sequence |
>54556 : length: 418 MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMK EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |