|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 54739 |
Name | XAF1 |
Synonym | BIRC4BP|HSXIAPAF1|XIAPAF1;XIAP associated factor 1;XAF1;XIAP associated factor 1 |
Definition | BIRC4 binding protein|BIRC4-binding protein|XIAP-associated factor 1 |
Position | 17p13.1 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 3 PubMed records as below. |
Evidence Status |
Description |
reviewed | [5-azacytidine treatment induces tumor suppressor gene XAF1 expression and inhibits proliferation in myeloma cells]. |
reviewed | XAF1 may have a role as a tumor suppressor gene in advanced bladder cancer treated with neoadjuvant chemotherapy. |
potential | "Hypermethylation of XIAP-associated factor 1, a putative tumor suppressor gene from the 17p13.2 locus, in human gastric adenocarcinomas." |
More detail of all 3 literatures about XAF1 | |
External Links |
|
Links to Entrez Gene | 54739 |
Links to all GeneRIF Items | 54739 |
Links to iHOP | 54739 |
Sequence Information |
|
Nucleotide Sequence |
>54739 : length: 906 atggaaggagacttctcggtgtgcaggaactgtaaaagacatgtagtctctgccaacttc accctccatgaggcttactgcctgcggttcctggtcctgtgtccggagtgtgaggagcct gtccccaaggaaaccatggaggagcactgcaagcttgagcaccagcaggttgggtgtacg atgtgtcagcagagcatgcagaagtcctcgctggagtttcataaggccaatgagtgccag gagcgccctgttgagtgtaagttctgcaaactggacatgcagctcagcaagctggagctc cacgagtcctactgtggcagccggacagagctctgccaaggctgtggccagttcatcatg caccgcatgctcgcccagcacagagatgtctgtcgcagtgaacaggcccagctcgggaaa ggggaaagaatttcagctcctgaaagggaaatctactgtcattattgcaaccaaatgatt ccagaaaataagtatttccaccatatgggtaaatgttgtccagactcagagtttaagaaa cactttcctgttggaaatccagaaattcttccttcatctcttccaagtcaagctgctgaa aatcaaacttccacgatggagaaagatgttcgtccaaagacaagaagtataaacagattt cctcttcattctgaaagttcatcaaagaaagcaccaagaagcaaaaacaaaaccttggat ccacttttgatgtcagagcccaagcccaggaccagctcccctagaggagataaagcagcc tatgacattctgaggagatgttctcagtgtggcatcctgcttcccctgccgatcctaaat caacatcaggagaaatgccggtggttagcttcatcaaaaggaaaacaagtgagaaatttc agctag |
Protein Sequence |
>54739 : length: 301 MEGDFSVCRNCKRHVVSANFTLHEAYCLRFLVLCPECEEPVPKETMEEHCKLEHQQVGCT MCQQSMQKSSLEFHKANECQERPVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIM HRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYCNQMIPENKYFHHMGKCCPDSEFKK HFPVGNPEILPSSLPSQAAENQTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLD PLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNF S |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |