|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 54766 |
Name | BTG4 |
Synonym | PC3B;B-cell translocation gene 4;BTG4;B-cell translocation gene 4 |
Definition | BTG family member 4|protein BTG4|protein PC3b |
Position | 11q23 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
potential | these data support BTG4 as a candidate tumor suppressor gene that is epigenetically silenced in the majority of gastric cancers. |
potential | "miR-34b/c and BTG4 are novel tumor suppressors in colorectal cancer (CRC) and that the miR-34b/c CpG island, which bidirectionally regulates miR-34b/c and BTG4, is a frequent target of epigenetic silencing in CRC". |
| More detail of all 2 literatures about BTG4 | |
|
External Links |
|
Links to Entrez Gene | 54766 |
Links to all GeneRIF Items | 54766 |
Links to iHOP | 54766 |
|
Sequence Information |
|
Nucleotide Sequence |
>54766 : length: 672 atgagagatgaaattgcaacaacagttttctttgtcacaagattggtgaaaaaacatgat aaactaagtaaacagcaaatagaagactttgcagaaaagctgatgacgatcttgtttgaa acatacagaagtcactggcactctgattgcccttctaaagggcaagccttcaggtgcatc aggataaacaacaatcagaataaagatcccattctagaaagggcatgtgtggaaagtaat gtagatttttctcacctgggacttccgaaggagatgaccatatgggtagatccctttgaa gtatgctgtaggtatggtgagaaaaaccatccatttacagttgcttcttttaaaggcaga tgggaggaatgggaactatatcaacaaatcagttatgccgttagtagagcctcatcagac gtttcctctggcacttcctgcgatgaagaaagttgtagcaaggaacctcgtgtcattcct aaagtcagcaatccgaagagtatttatcaggttgaaaacttgaaacagccctttcaatct tggttacaaatcccccgcaaaaagaatgtggtggacggccgtgttggcctcctgggaaac acttaccatggctcgcagaagcatcctaagtgttacaggcctgctatgcaccggctggac agaattttataa |
Protein Sequence |
>54766 : length: 223 MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCI RINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR WEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVENLKQPFQS WLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL |