|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 54979 |
Name | HRASLS2 |
Synonym | PLA1/2-2;HRAS-like suppressor 2;HRASLS2;HRAS-like suppressor 2 |
Definition | - |
Position | 11q12.3 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | "The tumor suppressors TIG3, HRASLS2 and H-rev107 are involved in the phospholipid metabolism with different physiological roles." |
| More detail of all 1 literatures about HRASLS2 | |
|
External Links |
|
Links to Entrez Gene | 54979 |
Links to all GeneRIF Items | 54979 |
Links to iHOP | 54979 |
|
Sequence Information |
|
Nucleotide Sequence |
>54979 : length: 489 atggctttggccagaccaagaccgagacttggagacctgattgagatttctcgctttggc tatgcacactgggccatctacgtgggagatggctatgtggtccatctggctccggcaagt gaaattgctggagctggtgcggccagtgtcctgtctgccctgaccaacaaagccatagtg aagaaggaactgctgtctgtggtggctgggggagacaactacagggtcaataacaagcac gatgacagatacacaccactgccttccaacaaaatcgtcaagcgggcagaggagttggtg gggcaggagttgccttattcgctgaccagtgacaactgcgagcacttcgtgaaccatctg cgctatggcgtctcccgcagtgaccaggtcactggtgcagtcacgacagtaggtgtggca gcaggcctgctggctgccgcaagccttgtggggatcctgctggccagaagcaagcgggaa aggcaataa |
Protein Sequence |
>54979 : length: 162 MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIV KKELLSVVAGGDNYRVNNKHDDRYTPLPSNKIVKRAEELVGQELPYSLTSDNCEHFVNHL RYGVSRSDQVTGAVTTVGVAAGLLAAASLVGILLARSKRERQ |