|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5524 |
Name | PPP2R4 |
Synonym | PP2A|PR53|PTPA;protein phosphatase 2A activator, regulatory subunit 4;PPP2R4;protein phosphatase 2A activator, regulatory subunit 4 |
Definition | PP2A phosphatase activator|PP2A subunit B' isoform PR53|phosphotyrosyl phosphatase activator|protein phosphatase 2A, regulatory subunit B' (PR 53)|serine/threonine-protein phosphatase 2A activator|serine/threonine-protein phosphatase 2A regulatory subunit |
Position | 9q34 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | "the dynamic nuclear distribution of the B56gamma3 regulatory subunit controls nuclear PP2A activity, which regulates cell cycle controllers, such as p27, to restrain cell cycle progression, and may be responsible for the tumor suppressor function of PP2A". |
reviewed | These observations identify PP2A Abeta as a tumor suppressor gene that transforms immortalized human cells by regulating the function of RalA. |
potential | These observations identify PP2A Abeta as a tumor suppressor gene that transforms immortalized human cells by regulating the function of RalA. |
potential | The tumor suppressor PP2A is functionally inactivated in blast crisis CML through the inhibitory activity of the BCR/ABL-regulated SET protein. |
| More detail of all 3 literatures about PPP2R4 | |
|
Pathways and Diseases |
|
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | p53 pathway;PID Curated;200175 |
|
External Links |
|
Links to Entrez Gene | 5524 |
Links to all GeneRIF Items | 5524 |
Links to iHOP | 5524 |
|
Sequence Information |
|
Nucleotide Sequence |
>5524 : length: 867 atgggcaaatggaagcgttctcaggcatacgctgactacatcggattcatccttaccctc aacgaaggtgtgaaggggaagaagctgaccttcgagtacagagtctccgaggccattgag aaactagtcgctcttctcaacacgctggacaggtggattgatgagactcctccagtggac cagccctctcggtttgggaataaggcatacaggacctggtatgccaaacttgatgaggaa gcagaaaacttggtggccacagtggtccctacccatctggcagctgctgtgcctgaggtg gctgtttacctaaaggagtcagtggggaactccacgcgcattgactacggcacagggcat gaggcagccttcgctgctttcctctgctgtctctgcaagattggggtgctccgggtggat gaccaaatagctattgtcttcaaggtgttcaatcggtaccttgaggttatgcggaaactc cagaaaacatacaggatggagccagccggcagccagggagtgtggggtctggatgacttc cagtttctgcccttcatctggggcagttcgcagctgatagaccacccatacctggagccc agacactttgtggatgagaaggccgtgaatgagaaccacaaggactacatgttcctggag tgtatcctgtttattaccgagatgaagactggcccatttgcagagcactccaaccagctg tggaacatcagcgccgtcccttcctggtccaaagtgaaccagggtctcatccgcatgtat aaggccgagtgcctggagaagttccctgtgatccagcacttcaagttcgggagcctgctg cccatccatcctgtcacgtcgggctag |
Protein Sequence |
>5524 : length: 288 MGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVD QPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGH EAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDF QFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQL WNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG |