|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 55654 |
Name | TMEM127 |
Synonym | -;transmembrane protein 127;TMEM127;transmembrane protein 127 |
Definition | - |
Position | 2q11.2 |
Gene Type | protein-coding |
Source | Count: 2; Generif,UniProt |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | Germline mutations in TMEM127 confer susceptibility to pheochromocytoma and identify TMEM127 as a tumor suppressor gene. |
More detail of all 1 literatures about TMEM127 | |
External Links |
|
Links to Entrez Gene | 55654 |
Links to all GeneRIF Items | 55654 |
Links to iHOP | 55654 |
Sequence Information |
|
Nucleotide Sequence |
>55654 : length: 717 atgtacgcccccggaggcgcagggctgcccggcgggcgccggcggaggagcccgggaggc agcgctctgcccaagcagccggagcgtagcctggcctcggccctgcctggcgccctgtct atcacggcgctgtgcactgccctcgccgagcccgcctggttgcacatccacggaggcacc tgttcgcgccaggagctgggggtctccgacgtgttgggctatgtgcacccggacctgctg aaagatttctgcatgaatccccagacagtgctgctcctgcgggtcatcgccgccttctgt ttcctgggcatcctgtgtagtctctccgctttccttctggatgtctttgggccgaagcat cctgctctgaagatcactcgtcgctatgccttcgcccatatcctaacggttctgcagtgt gccaccgtcattggcttttcttattgggcttctgaactcatcttggcccagcagcagcag cataagaagtaccatggatcccaggtctatgtcaccttcgccgttagcttctacctggtg gcaggagctggtggagcctcaatcctggccacggcagccaacctcctgcgccactacccc acagaggaagaggagcaggcgctggagctgctctcagagatggaagagaacgagccctac ccggcggaatatgaggtcatcaaccagttccagccaccccctgcttacacaccctaa |
Protein Sequence |
>55654 : length: 238 MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGT CSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKH PALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLV AGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |