|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5655 |
Name | KLK10 |
Synonym | NES1|PRSSL1;kallikrein-related peptidase 10;KLK10;kallikrein-related peptidase 10 |
Definition | breast normal epithelial cell associated serine protease|kallikrein 10|kallikrein-10|normal epithelial cell-specific 1|protease serine-like 1|protease, serine-like, 1 |
Position | 19q13 |
Gene Type | protein-coding |
Source | Count: 2; Generif,UniProt |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | The role for NES1 serine protease as a novel tumor suppressor. |
potential | "The normal epithelial cell-specific 1 (NES1) gene, a candidate tumor suppressor gene on chromosome 19q13.3-4, is downregulated by hypermethylation in acute lymphoblastic leukemia." |
potential | Loss of expression of the putative tumor suppressor NES1 gene in biopsy-proven ductal carcinoma in situ predicts for invasive carcinoma at definitive surgery. |
potential | Expression of the normal epithelial cell-specific 1 (NES1; KLK10) candidate tumour suppressor gene in normal and malignant testicular tissue. |
| More detail of all 4 literatures about KLK10 | |
|
External Links |
|
Links to Entrez Gene | 5655 |
Links to all GeneRIF Items | 5655 |
Links to iHOP | 5655 |
|
Sequence Information |
|
Nucleotide Sequence |
>5655 : length: 831 atgagagctccgcacctccacctctccgccgcctctggcgcccgggctctggcgaagctg ctgccgctgctgatggcgcaactctgggccgcagaggcggcgctgctcccccaaaacgac acgcgcttggaccccgaagcctatggctccccgtgcgcgcgcggctcgcagccctggcag gtctcgctcttcaacggcctctcgttccactgcgcgggtgtcctggtggaccagagttgg gtgctgacggccgcgcactgcggaaacaagccactgtgggctcgagtaggggatgaccac ctgctgcttcttcagggagagcagctccgccggaccactcgctctgttgtccatcccaag taccaccagggctcaggccccatcctgccaaggcgaacggatgagcacgatctcatgttg ctgaagctggccaggcccgtagtgctggggccccgcgtccgggccctgcagcttccctac cgctgtgctcagcccggagaccagtgccaggttgctggctggggcaccacggccgcccgg agagtgaagtacaacaagggcctgacctgctccagcatcactatcctgagccctaaagag tgtgaggtcttctaccctggcgtggtcaccaacaacatgatatgtgctggactggaccgg ggccaggacccttgccagagtgactctggaggccccctggtctgtgacgagaccctccaa ggcatcctctcgtggggtgtttacccctgtggctctgcccagcatccagctgtctacacc cagatctgcaaatacatgtcctggatcaataaagtcatacgctccaactga |
Protein Sequence |
>5655 : length: 276 MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQ VSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPK YHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAAR RVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN |