|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56849 |
Name | TCEAL7 |
Synonym | MPMGp800C04260Q003;transcription elongation factor A (SII)-like 7;TCEAL7;transcription elongation factor A (SII)-like 7 |
Definition | TCEA-like protein 7|transcription elongation factor A protein-like 7|transcription elongation factor S-II protein-like 7 |
Position | Xq22.1 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | "TCEAL7, a putative tumor suppressor gene, negatively regulates NF-kappaB pathway." |
potential | "A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation." |
potential | "TCEAL7 is a cell death regulatory protein that is frequently inactivated in ovarian cancers, and may function as a tumor suppressor." |
| More detail of all 3 literatures about TCEAL7 | |
|
External Links |
|
Links to Entrez Gene | 56849 |
Links to all GeneRIF Items | 56849 |
Links to iHOP | 56849 |
|
Sequence Information |
|
Nucleotide Sequence |
>56849 : length: 303 atgcaaaaaccctgcaaagaaaacgaaggaaagccaaagtgcagcgtgccaaagagggag gaaaaacgcccgtatggagaatttgaacgccagcaaacagaagggaattttagacagagg ctgcttcagtctctcgaagaatttaaagaggacatagactataggcattttaaagatgaa gaaatgacaagggagggagatgagatggaaaggtgtttggaagagataaggggtctgaga aagaaatttagggctctgcattctaaccataggcattctcgggaccgtccttatcccatt taa |
Protein Sequence |
>56849 : length: 100 MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI |