|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 56954 |
Name | NIT2 |
Synonym | -;nitrilase family, member 2;NIT2;nitrilase family, member 2 |
Definition | Nit protein 2|nitrilase homolog 2|omega-amidase NIT2 |
Position | 3q12.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
potential | "Genotype analysis in 4 types of tumor tissue showed allelic imbalance surrounding NIT2 locus; results show that NIT2 plays an important role in cell growth inhibition & links to malignancies, suggesting Nit2 may be a potential tumor suppressor candidate". |
potential | "Molecular identification of omega-amidase, the enzyme that is functionally coupled with glutamine transaminases, as the putative tumor suppressor Nit2." |
potential | "Identification of the putative tumor suppressor Nit2 as omega-amidase, an enzyme metabolically linked to glutamine and asparagine transamination." |
| More detail of all 3 literatures about NIT2 | |
|
Pathways and Diseases |
|
Pathway | Alanine, aspartate and glutamate metabolism;KEGG PATHWAY;hsa00250 |
Disease | Cancer;FunDO |
|
External Links |
|
Links to Entrez Gene | 56954 |
Links to all GeneRIF Items | 56954 |
Links to iHOP | 56954 |
|
Sequence Information |
|
Nucleotide Sequence |
>56954 : length: 831 atgacctctttccgcttggccctcatccagcttcagatttcttccatcaaatcagataac gtcactcgcgcttgtagcttcatccgggaggcagcaacgcaaggagccaaaatagtttct ttgccggaatgctttaattctccatatggagcgaaatattttcctgaatatgcagagaaa attcctggtgaatccacacagaagctttctgaagtagcaaaggaatgcagcatatatctc attggaggctctatccctgaagaggatgctgggaaattatataacacctgtgctgtgttt gggcctgatggaactttactagcaaagtatagaaagatccatctgtttgacattgatgtt cctggaaaaattacatttcaagaatctaaaacattgagtccgggtgatagtttctccaca tttgatactccttactgcagagtgggtctgggcatctgctacgacatgcggtttgcagag cttgcacaaatctacgcacagagaggctgccagctgttggtatatccaggagcttttaat ctgaccactggaccagcccattgggagttacttcagcgaagccgggctgttgataatcag gtgtatgtggccacagcctctcctgcccgggatgacaaagcctcctatgttgcctgggga cacagcaccgtggtgaacccttggggggaggttctagccaaagctggcacagaagaagca atcgtgtattcagacatagacctgaagaagctggctgaaatacgccagcaaatccccgtt tttagacagaagcgatcagacctctatgctgtggagatgaaaaagccctaa |
Protein Sequence |
>56954 : length: 276 MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK IPGESTQKLSEVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDV PGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFN LTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEA IVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP |