|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 57447 |
Name | NDRG2 |
Synonym | SYLD;NDRG family member 2;NDRG2;NDRG family member 2 |
Definition | N-myc downstream regulator 2|NDR1-related protein NDR2|cytoplasmic protein Ndr1|protein NDRG2|syld709613 protein |
Position | 14q11.2 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,Generif,UniProt |
Literature support | Count: 7 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Crystal structure of the human N-Myc downstream-regulated gene 2 protein provides insight into its role as a tumor suppressor. |
potential | NDRG2 is a candidate tumor-suppressor for oral squamous-cell carcinoma. |
potential | [Expression and significance of new candidate tumor suppressor gene N-Myc downstream-regulated gene 2 in colorectal cancer]. |
potential | "NDRG2 as a candidate tumor suppressor gene that is epigenetically silenced in the majority of primary glioblastomas, but not in lower grade astrocytomas and secondary glioblastomas." |
potential | [Expression of candidate tumor suppressor gene N-Myc downstream-regulated gene 2 in colon cancer]. |
potential | NDRG2 might play an important role in the carcinogenesis and development of clear cell renal cell carcinoma and may function as a tumor suppressor in clear cell renal cell carcinoma. |
potential | Data identify NDRG2 as the first specific candidate tumor suppressor gene on chromosome 14q that is inactivated during meningioma progression. |
| More detail of all 7 literatures about NDRG2 | |
|
Pathways and Diseases |
|
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Disease | Cancer;FunDO |
Disease | Alzheimer's disease;FunDO |
|
External Links |
|
Links to Entrez Gene | 57447 |
Links to all GeneRIF Items | 57447 |
Links to iHOP | 57447 |
|
Sequence Information |
|
Nucleotide Sequence |
>57447 : length: 1074 atggcggagctgcaggaggtgcagatcacagaggagaagccactgttgccaggacagacg cctgaggcggccaagactcactctgtggagacaccatacggctctgtcactttcactgtc tatggcacccccaaacccaaacgcccagcgatccttacctaccacgatgtgggactcaac tataaatcttgcttccagccactgtttcagttcgaggacatgcaggaaatcattcagaac tttgtgcgggttcatgtggatgcccctggaatggaagagggagcccctgtgttccctttg ggatatcagtacccatctctggaccagcttgcagacatgatcccttgcgtcctgcagtac ctaaatttctctacaataattggagttggtgttggagctggagcctacatcctggcgaga tatgctcttaaccacccggacactgttgaaggtcttgtcctcatcaacattgatcccaat gccaagggttggatggattgggcagcccacaagctaacaggcctcacctcttccattccg gagatgatccttggacatcttttcagccaggaagagctctctggaaattctgagttgata caaaagtacagaaatatcattacacatgcacccaacctggataacattgaattgtactgg aacagctacaacaaccgccgagacctgaactttgagcgtggaggtgatatcaccctcagg tgtcctgtgatgctggtggtaggagaccaagcacctcatgaagatgcagtggtggaatgt aactcaaaactggaccccacccagacctcgttcctcaagatggctgactccggaggtcag ccccagctgactcagccaggcaagctgaccgaggccttcaagtacttcctgcaaggcatg ggctacatggcctcatcctgcatgactcgcctgtcccggtctcgtacagcctctctgacc agtgcagcatccgttgatggcaaccggtcccgctctcgcaccctgtcccagagcagcgag tctggaactctttcttcggggcccccggggcacaccatggaggtctcctgttga |
Protein Sequence |
>57447 : length: 357 MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLN YKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQY LNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIP EMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLR CPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGM GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC |