|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 5795 |
Name | PTPRJ |
Synonym | CD148|DEP1|HPTPeta|R-PTP-ETA|SCC1;protein tyrosine phosphatase, receptor type, J;PTPRJ;protein tyrosine phosphatase, receptor type, J |
Definition | CD148 antigen|DEP-1|HPTP eta|R-PTP-J|density-enhanced phosphatase 1|human density enhanced phosphatase-1|protein tyrosine phosphatase, receptor type, J polypeptide|protein-tyrosine phosphatase eta|protein-tyrosine phosphatase receptor type J|receptor-type |
Position | 11p11.2 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 5 PubMed records as below. |
Evidence Status | Description |
reviewed | Germline epigenetic silencing of the tumor suppressor gene PTPRJ in early-onset familial colorectal cancer. |
reviewed | DEP-1 is a tumor suppressor that dephosphorylates and thereby stabilizes EGFR by hampering its ability to associate with the CBL-GRB2 ubiquitin ligase complex. |
reviewed | tumor suppressor density-enhanced phosphatase-1 (DEP-1) inhibits the RAS pathway by direct dephosphorylation of ERK1/2 kinases. |
potential | "A candidate tumor suppressor gene because its expression was blocked in rat and human thyroid transformed cells, and its restoration reverted their neoplastic phenotype." |
potential | negative regulation of growth-factor stimulated cell migration and promotion of cell-matrix adhesion may be related to the function of DEP-1 as tumor suppressor. |
| More detail of all 5 literatures about PTPRJ | |
Pathways and Diseases | |
Pathway | Adherens junction;KEGG PATHWAY;hsa04520 |
Pathway | Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032 |
Pathway | PDGFR-beta signaling pathway;PID Curated;200127 |
Disease | Hypothyroidism;FunDO |
Disease | Thyroid cancer;FunDO |
Disease | Colon cancer, somatic;OMIM |
Disease | thyroid cancer;GAD |
Disease | CANCER;GAD |
Disease | Deafness;FunDO |
Disease | Brain tumor;FunDO |
Disease | Breast cancer;FunDO |
External Links | |
Links to Entrez Gene | 5795 |
Links to all GeneRIF Items | 5795 |
Links to iHOP | 5795 |
Sequence Information | |
Nucleotide Sequence | >5795 : length: 1620 atgaagccggcggcgcgggaggcgcggctgcctccgcgctcgcccgggctgcgctgggcg ctgccgctgctgctgctgctgctgcgcctgggccagatcctgtgcgcaggtggcacccct agtccaattcctgacccttcagtagcaactgttgccacaggggaaaatggcataacgcag atcagcagtacagcagaatcctttcataaacagaatggaactggaacacctcaggtggaa acaaacaccagtgaggatggtgaaagctctggagccaacgatagtttaagaacacctgaa caaggatctaatgggactgatggggcatctcaaaaaactcccagtagcactgggcccagt cctgtgtttgacattaaagctgtttccatcagtccaaccaatgtgatcttaacttggaaa agtaatgacacagctgcttctgagtacaagtatgtagtaaagcataagatggaaaatgag aagacaattactgttgtgcatcaaccatggtgtaacatcacaggcttacgtccagcgact tcatatgtattctccatcactccaggaataggcaatgagacttggggagatcccagagtc ataaaagtcatcacagagccgatcccagtttctgatctccgtgttgccctcacgggtgtg aggaaggctgctctctcctggagcaatggcaatggcactgcctcctgccgggttcttctt gaaagcattggaagccatgaggagttgactcaagactcaagacttcaggtcaatatctcg ggcctgaagccaggggttcaatacaacatcaacccgtatcttctacaatcaaataagaca aagggagaccccttgggcacagaaggtggcttggatgccagcaatacagagagaagccgg gcagggagccccaccgcccctgtgcatgatgagtccctcgtgggacctgtggacccatcc tccggccagcagtcccgagacacggaagtcctgcttgtcgggttagagcctggcacccga tacaatgccaccgtttattcccaagcagcgaatggcacagaaggacagccccaggccata gagttcaggacaaatgctattcaggtttttgacgtcaccgctgtgaacatcagtgccaca agcctgaccctgatctggaaagtcagcgataacgagtcgtcatctaactatacctacaag atacatgtggcgggggagacagattcttccaatctcaacgtcagtgagcctcgcgctgtc atccccggactccgctccagcaccttctacaacatcacagtgtgtcctgtcctaggtgac atcgagggcacgccgggcttcctccaagtgcacaccccccctgttccagtttctgacttc cgagtgacagtggtcagcacgacggagatcggcttagcatggagcagccatgatgcagaa tcatttcagatgcatatcacacaggagggagctggcaattctcgggtagaaataaccacc aaccaaagtattatcattggtggcttgttccctggaaccaagtattgctttgaaatagtt ccaaaaggaccaaatgggactgaaggggcatctcggacagtttgcaatagaactggatga |
Protein Sequence | >5795 : length: 539 MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTG |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |