|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 581 |
Name | BAX |
Synonym | BCL2L4;BCL2-associated X protein;BAX;BCL2-associated X protein |
Definition | apoptosis regulator BAX|bcl-2-like protein 4|bcl2-L-4 |
Position | 19q13.3-q13.4 |
Gene Type | protein-coding |
Source | Count: 1; Pubmed_search |
Literature support | Count: 2 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Proteins of the Bcl2 family regulate the permeability of the mitochondrial membrane for AIF and cytochrome c. This family of structurally related proteins consists of more than twenty members including bcl2 and bcl-x protooncogene products that can block apoptosis and tumor suppressor Bax that on the contrary can induce apoptosis. |
reviewed | "BAX and BAK mediate p53-independent suppression of tumorigenesis. Thus, BAX and BAK function to suppress tumorigenesis, and their deficiency was selected for in vivo. ". |
| More detail of all 2 literatures about BAX | |
|
External Links |
|
Links to Entrez Gene | 581 |
Links to all GeneRIF Items | 581 |
Links to iHOP | 581 |
|
Sequence Information |
|
Nucleotide Sequence |
>581 : length: 657 atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggtgaga ctcctcaagcctcctcacccccaccaccgcgccctcaccaccgcccctgccccaccgtcc ctgccccccgccactcctctgggaccctgggccttctggagcaggtcacagtggtgccct ctccccatcttcagatcatcagatgtggtctataatgcgttttccttacgtgtctga |
Protein Sequence |
>581 : length: 218 MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRLLKPPHPHHRALTTAPAPPS LPPATPLGPWAFWSRSQWCPLPIFRSSDVVYNAFSLRV |