|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5889 |
Name | RAD51C |
Synonym | BROVCA3|FANCO|RAD51L2;RAD51 homolog C (S. cerevisiae);RAD51C;RAD51 homolog C (S. cerevisiae) |
Definition | DNA repair protein RAD51 homolog 3|R51H3|RAD51 homolog C|RAD51-like protein 2|yeast RAD51 homolog 3 |
Position | 17q25.1 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | unravel the critical role of RAD51C in the FA pathway of ICL repair and as a tumor suppressor. |
| More detail of all 1 literatures about RAD51C | |
|
Pathways and Diseases |
|
Pathway | Homologous recombination;KEGG PATHWAY;hsa03440 |
Disease | Fanconi anemia, complementation group 0;OMIM |
Disease | Breast-ovarian cancer, familial, susceptibility to, 3;OMIM |
|
External Links |
|
Links to Entrez Gene | 5889 |
Links to all GeneRIF Items | 5889 |
Links to iHOP | 5889 |
|
Sequence Information |
|
Nucleotide Sequence |
>5889 : length: 408 atgcgcgggaagacgttccgctttgaaatgcagcgggatttggtgagtttcccgctgtct ccagcggtgcgggtgaagctggtgtctgcggggttccagactgctgaggaactcctagag gtgaaaccctccgagcttagcaaagaagttgggatatctaaagcagaagccttagaaact ctgcaaattatcagaagagaatgtctcacaaataaaccaagatatgctggtacatctgag tcacacaagaagtgtacagcactggaacttcttgagcaggagcatacccagggcttcata atcaccttctgttcagcactagatgatattcttgggggtggagtgcccttaatgaaaaca acagaaatttgtggtgcaccaggtgttggaaaaacacaattatggtaa |
Protein Sequence |
>5889 : length: 135 MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT TEICGAPGVGKTQLW |