|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5915 |
Name | RARB |
Synonym | HAP|NR1B2|RRB2;retinoic acid receptor, beta;RARB;retinoic acid receptor, beta |
Definition | HBV-activated protein|RAR-beta|RAR-epsilon|hepatitis B virus activated protein|nuclear receptor subfamily 1 group B member 2|retinoic acid receptor beta|retinoic acid receptor beta 2|retinoic acid receptor beta 4|retinoic acid receptor beta 5|retinoic aci |
Position | 3p24 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 11 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Aberrant methylation of tumor suppressor genes in patients with refractory anemia with ring sideroblasts. |
reviewed | "Combined effects of cigarette smoking, gene polymorphisms and methylations of tumor suppressor genes on non small cell lung cancer: a hospital-based case-control study in China." |
reviewed | CpG island tumor suppressor promoter methylation in non-BRCA-associated early mammary carcinogenesis. |
reviewed | Allelic methylation bias of the RARB2 tumor suppressor gene promoter in cancer. |
reviewed | Association of aberrant methylation of tumor suppressor genes with tumor aggressiveness and BRAF mutation in papillary thyroid cancer. |
potential | RARbeta2 induces a number of tumor suppressor functions and metastasis suppressors. |
potential | (RAR)beta functions as a tumor suppressor gene in various contexts where its absence is associated with tumorigenicity and its presence causes cell cycle arrest. |
potential | RARbeta2 acts as a tumor suppressor gene in myelofibrosis with myeloid metaplasia and epigenetic changes are the most significant determinants of RARbeta2 gene activity in these patients. |
reviewed | "Allele loss and promoter hypermethylation of VHL, RAR-beta, RASSF1A, and FHIT tumor suppressor genes on chromosome 3p in esophageal squamous cell carcinoma." |
potential | Endogenous reactivation of the RARbeta2 tumor suppressor gene epigenetically silenced in breast cancer. |
| More detail of all 11 literatures about RARB | |
|
Pathways and Diseases |
|
Pathway | Pathways in cancer;KEGG PATHWAY;hsa05200 |
Pathway | Gene Expression;Reactome;REACT:71 |
Pathway | Non-small cell lung cancer;KEGG PATHWAY;hsa05223 |
Pathway | Small cell lung cancer;KEGG PATHWAY;hsa05222 |
Disease | Cancers;KEGG DISEASE |
Disease | Non-small cell lung cancer;KEGG DISEASE;H00014 |
Disease | Small cell lung cancer;KEGG DISEASE;H00013 |
Disease | Cancers of the lung and pleura;KEGG DISEASE |
Disease | Rheumatoid arthritis;FunDO |
Disease | Congenital abnormality;FunDO |
Disease | obesity (extreme);GAD |
Disease | Cancer;FunDO |
Disease | METABOLIC;GAD |
Disease | Obesity (extreme);NHGRI |
|
External Links |
|
Links to Entrez Gene | 5915 |
Links to all GeneRIF Items | 5915 |
Links to iHOP | 5915 |
|
Sequence Information |
|
Nucleotide Sequence |
>5915 : length: 1347 atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg acccaaaccgaatggcagcatcggcacactgctcaatcaattgaaacacagagcaccagc tctgaggaactcgtcccaagccccccatctccacttcctccccctcgagtgtacaaaccc tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga tgtaagggctttttccgcagaagtattcagaagaatatgatttacacttgtcaccgagat aagaactgtgttattaataaagtcaccaggaatcgatgccaatactgtcgactccagaag tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagttggacgatctc acagagaagatccgaaaagctcaccaggaaactttcccttcactctgccagctgggtaaa tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa ttcagtgaactggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcct ggtttcactggcttgaccatcgcagaccaaattaccctgctgaaggccgcctgcctggac atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttctca gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgtagcatc agtgctaaaggtgcagagcgtgtaattaccttgaaaatggaaattcctggatcaatgcca cctctcattcaagaaatgctggagaattctgaaggacatgaacccttgaccccaagttca agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagtggg gtcagtcagtcaccactcgtgcaataa |
Protein Sequence |
>5915 : length: 448 MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS SGNTAEHSPSISPSSVENSGVSQSPLVQ |