|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 5920 |
Name | RARRES3 |
Synonym | HRASLS4|PLA1/2-3|RIG1|TIG3;retinoic acid receptor responder (tazarotene induced) 3;RARRES3;retinoic acid receptor responder (tazarotene induced) 3 |
Definition | RAR-responsive protein TIG3|retinoic acid receptor responder protein 3|retinoic acid-inducible gene 1|retinoid-inducible gene 1 protein|tazarotene-induced gene 3 protein |
Position | 11q23 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 9 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Identification and characterization of a retinoid-induced class II tumor suppressor/growth regulatory gene. |
reviewed | TIG3 tumor suppressor-dependent organelle redistribution and apoptosis in skin cancer cells. |
reviewed | "The tumor suppressors TIG3, HRASLS2 and H-rev107 are involved in the phospholipid metabolism with different physiological roles." |
reviewed | Suppression of the TIG3 tumor suppressor gene in human ovarian carcinomas is mediated via mitogen-activated kinase-dependent and -independent mechanisms. |
reviewed | Decreased expression of type II tumor suppressor gene RARRES3 in tissues of hepatocellular carcinoma and cholangiocarcinoma. |
reviewed | A novel tumor suppressor protein promotes keratinocyte terminal differentiation via activation of type I transglutaminase. |
potential | "Induction of TIG3, a putative class II tumor suppressor gene, by retinoic acid in head and neck and lung carcinoma cells and its association with suppression of the transformed phenotype." |
reviewed | "The carboxy-terminal hydrophobic domain of TIG3, a class II tumor suppressor protein, is required for appropriate cellular localization and optimal biological activity." |
reviewed | "Expression of a retinoid-inducible tumor suppressor, Tazarotene-inducible gene-3, is decreased in psoriasis and skin cancer." |
| More detail of all 9 literatures about RARRES3 | |
|
External Links |
|
Links to Entrez Gene | 5920 |
Links to all GeneRIF Items | 5920 |
Links to iHOP | 5920 |
|
Sequence Information |
|
Nucleotide Sequence |
>5920 : length: 495 atggcttcgccacaccaagagcccaaacctggagacctgattgagattttccgccttggc tatgagcactgggccctgtatataggagatggctacgtgatccatctggctcctccaagt gagtaccccggggctggctcctccagtgtcttctcagtcctgagcaacagtgcagaggtg aaacgggagcgcctggaagatgtggtgggaggctgttgctatcgggtcaacaacagcttg gaccatgagtaccaaccacggcccgtggaggtgatcatcagttctgcgaaggagatggtt ggtcagaagatgaagtacagtattgtgagcaggaactgtgagcactttgtcacccagctg agatatggcaagtcccgctgtaaacaggtggaaaaggccaaggttgaagttggtgtggcc acggcgcttggaatcctggttgttgctggatgctcttttgcgattaggagataccaaaaa aaagcgacagcctga |
Protein Sequence |
>5920 : length: 164 MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEV KRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQL RYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA |