|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 6134 |
Name | RPL10 |
Synonym | AUTSX5|DXS648|DXS648E|L10|NOV|QM;ribosomal protein L10;RPL10;ribosomal protein L10 |
Definition | 60S ribosomal protein L10|Wilms tumor-related protein|laminin receptor homolog|tumor suppressor QM |
Position | Xq28 |
Gene Type | protein-coding |
Source | Count: 3; Pubmed_search,TAG,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status | Description |
potential | The primary structure of rat ribosomal protein L10: relationship to a Jun-binding protein and to a putative Wilms' tumor suppressor. |
potential | "QM, a putative tumor suppressor, regulates proto-oncogene c-yes." |
| More detail of all 2 literatures about RPL10 | |
Pathways and Diseases | |
Pathway | Diabetes pathways;Reactome;REACT:15380 |
Pathway | Influenza Infection;Reactome;REACT:6167 |
Pathway | Metabolism of proteins;Reactome;REACT:17015 |
Pathway | Regulation of beta-cell development;Reactome;REACT:13698 |
Pathway | Ribosome;KEGG PATHWAY;hsa03010 |
Pathway | 3' -UTR-mediated translational regulation;Reactome;REACT:1762 |
Pathway | Gene Expression;Reactome;REACT:71 |
Pathway | L13a-mediated translational silencing of Ceruloplasmin expression;PID Reactome;500526 |
Disease | Cancer;FunDO |
Disease | Prostate cancer;FunDO |
External Links | |
Links to Entrez Gene | 6134 |
Links to all GeneRIF Items | 6134 |
Links to iHOP | 6134 |
Sequence Information | |
Nucleotide Sequence | >6134 : length: 645 atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac aagatgttgtcctgtgctggggctgacaggctccaaacaggcatgcgaggtgcctttgga aagccccagggcactgtggccagggttcacattggccaagttatcatgtccatccgcacc aagctgcagaacaaggagcatgtgattgaggccctgcgcagggccaagttcaagtttcct ggccgccagaagatccacatctcaaagaagtggggcttcaccaagttcaatgctgatgaa tttgaagacatggtggctgaaaagcggctcatcccagatggctgtggggtcaagtacatc cccaatcgtggccctctggacaagtggcgggccctgcactcatga |
Protein Sequence | >6134 : length: 214 MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE FEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |