|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6273 |
Name | S100A2 |
Synonym | CAN19|S100L;S100 calcium binding protein A2;S100A2;S100 calcium binding protein A2 |
Definition | S100 calcium-binding protein A2|protein S100-A2 |
Position | 1q21 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 4 PubMed records as below. |
|
Evidence Status |
Description |
potential | Repression of the candidate tumor suppressor gene S100A2 in breast cancer is mediated by site-specific hypermethylation. |
potential | "Diminished expression of S100A2, a putative tumor suppressor, is an independent predictive factor of neck node relapse in laryngeal squamous cell carcinoma." |
reviewed | Transcriptional activation of the tumor suppressor and differentiation gene S100A2 by a novel p63-binding site. |
potential | "S100A2 was down-regulated in lymph node metastasis of squamous cell carcinoma, head and neck neoplasms (SCCHN), suggesting that instead of being a putative tumor suppressor, S100A2 may play a role in the metastasis of SCCHN". |
| More detail of all 4 literatures about S100A2 | |
|
Pathways and Diseases |
|
Pathway | Direct p53 effectors;PID Curated;200101 |
Disease | Cancer;FunDO |
Disease | Neck cancer;FunDO |
Disease | Keratoconus;FunDO |
|
External Links |
|
Links to Entrez Gene | 6273 |
Links to all GeneRIF Items | 6273 |
Links to iHOP | 6273 |
|
Sequence Information |
|
Nucleotide Sequence |
>6273 : length: 294 atgtgcagttctctggagcaggcgctggctgtgctggtcactaccttccacaagtactcc tgccaagagggcgacaagttcaagctgagtaagggggaaatgaaggaacttctgcacaag gagctgcccagctttgtgggggagaaagtggatgaggaggggctgaagaagctgatgggc agcctggatgagaacagtgaccagcaggtggacttccaggagtatgctgttttcctggca ctcatcactgtcatgtgcaatgacttcttccagggctgcccagaccgaccctga |
Protein Sequence |
>6273 : length: 97 MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMG SLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |