|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 6390 |
Name | SDHB |
Synonym | IP|PGL4|SDH|SDH1|SDH2|SDHIP;succinate dehydrogenase complex, subunit B, iron sulfur (Ip);SDHB;succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
Definition | iron-sulfur subunit of complex II|succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial |
Position | 1p36.1-p35 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status |
Description |
reviewed | "In addition to gains of 1q and 5p, and losses of 10p and 13q14 approximately q22, this tumor had also losses of two regions to which tumor suppressor genes are mapped: 1p36 (SDHB) and 17q11.2 (NF1)". |
More detail of all 1 literatures about SDHB | |
Pathways and Diseases |
|
Pathway | Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.;Reactome;REACT:6305 |
Pathway | Pyruvate metabolism and Citric Acid (TCA) cycle;Reactome;REACT:1046 |
Pathway | Citrate cycle (TCA cycle);KEGG PATHWAY;hsa00020 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Oxidative phosphorylation;KEGG PATHWAY;hsa00190 |
Pathway | TCA cycle variation III (eukaryotic);BioCyc;PWY-5690 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Disease | Cowden-like syndrome;OMIM |
Disease | extra-adrenal and/or malignant phaeochromocytomas;GAD |
Disease | Paraganglioma, familial chromaffin, 4;OMIM |
Disease | prolonged survival associated;GAD |
Disease | pheochromocytomas;GAD |
Disease | paragangliomas;GAD |
Disease | head and neck cancer;GAD |
Disease | Paraganglioma and gastric stromal sarcoma;OMIM |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | paragangliomas, head and neck;GAD |
Disease | Pheochromocytoma;OMIM |
Disease | DEVELOPMENTAL;GAD |
Disease | height;GAD |
External Links |
|
Links to Entrez Gene | 6390 |
Links to all GeneRIF Items | 6390 |
Links to iHOP | 6390 |
Sequence Information |
|
Nucleotide Sequence |
>6390 : length: 843 atggcggcggtggtcgccctctccttgaggcgccggttgccggccacaacccttggcgga gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt gactccagagatgacttcacagaggagcgcctggccaagctgcaggacccattctctcta taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg aaagctattgcagagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt taa |
Protein Sequence |
>6390 : length: 280 MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |