|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 6392 |
Name | SDHD |
Synonym | CBT1|PGL|PGL1|SDH4;succinate dehydrogenase complex, subunit D, integral membrane protein;SDHD;succinate dehydrogenase complex, subunit D, integral membrane protein |
Definition | CII-4|QPs3|cybS|succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial|succinate dehydrogenase complex subunit D|succinate dehydrogenase ubiquinone cytochrome B small subunit|succinate-ubiquinone oxidoreductase cytochrome b small s |
Position | 11q23 |
Gene Type | protein-coding |
Source | Count: 1; Generif |
Literature support | Count: 1 PubMed records as below. |
Evidence Status | Description |
potential | SDHD may have a role in colorectal and gastric cancers as a distinct type of tumor suppressor. |
| More detail of all 1 literatures about SDHD | |
Pathways and Diseases | |
Pathway | Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.;Reactome;REACT:6305 |
Pathway | Pyruvate metabolism and Citric Acid (TCA) cycle;Reactome;REACT:1046 |
Pathway | Citrate cycle (TCA cycle);KEGG PATHWAY;hsa00020 |
Pathway | Metabolic pathways;KEGG PATHWAY;hsa01100 |
Pathway | Oxidative phosphorylation;KEGG PATHWAY;hsa00190 |
Pathway | TCA cycle variation III (eukaryotic);BioCyc;PWY-5690 |
Pathway | Alzheimer's disease;KEGG PATHWAY;hsa05010 |
Pathway | Respiratory electron transport;PID Reactome;500282 |
Pathway | Huntington's disease;KEGG PATHWAY;hsa05016 |
Pathway | Parkinson's disease;KEGG PATHWAY;hsa05012 |
Disease | Cowden-like syndrome;OMIM |
Disease | Cancers;KEGG DISEASE |
Disease | Paragangliomas, familial nonchromaffin, 1, with or without deafness;OMIM |
Disease | pheochromocytomas;GAD |
Disease | Merkel cell carcinoma, somatic;OMIM |
Disease | Paraganglioma and gastric stromal sarcoma;OMIM |
Disease | CANCER;GAD |
Disease | Cancer;FunDO |
Disease | Cancers of the digestive system;KEGG DISEASE |
Disease | paragangliomas, head and neck;GAD |
Disease | Carcinoid;KEGG DISEASE;H00034 |
Disease | Pheochromocytoma;OMIM |
Disease | Carcinoid tumors, intestinal;OMIM |
Disease | Actinic keratosis;FunDO |
External Links | |
Links to Entrez Gene | 6392 |
Links to all GeneRIF Items | 6392 |
Links to iHOP | 6392 |
Sequence Information | |
Nucleotide Sequence | >6392 : length: 480 atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattctggctccaag gctgcatctctccactggactagcgagagggttgtcagtgttttgctcctgggtctgctt ccggctgcttatttgaatccttgctctgcgatggactattccctggctgcagccctcact cttcatggtcactggggccttggacaagttgttactgactatgttcatggggatgccttg cagaaagctgccaaggcagggcttttggcactttcagctttaacctttgctgggctttgc tatttcaactatcacgatgtgggcatctgcaaagctgttgccatgctgtggaagctctga |
Protein Sequence | >6392 : length: 159 MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |