|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 6422 |
Name | SFRP1 |
Synonym | FRP|FRP-1|FRP1|FrzA|SARP2;secreted frizzled-related protein 1;SFRP1;secreted frizzled-related protein 1 |
Definition | SARP-2|sFRP-1|secreted apoptosis-related protein 2 |
Position | 8p11.21 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 7 PubMed records as below. |
Evidence Status | Description |
reviewed | The SFRP family of WNT inhibitors function as novel tumor suppressor genes epigenetically silenced in medulloblastoma. |
potential | "The data support a role for sFRP1 as a tumor suppressor in clear cell renal cell carcinoma and perhaps loss of sFRP1 is an early, aberrant molecular event in renal cell carcinogenesis." |
potential | "Down-regulation of SFRP1 as a candidate tumor suppressor gene, triggered by the epigenetic and/or genetic events, could contribute to the oncogenesis of hepatic cell carcinoma." |
potential | "SFRP 1 gene is frequently downregulated by promoter hypermethylation and suppresses tumor growth activity of lung cancer cells, which suggests that SFRP 1 is a candidate tumor suppressor gene for lung cancer". |
potential | These results indicate that the human secreted frizzled-related protein (hsFRP) gene probably functions as a tumor suppressor in normal cervical epithelium and down-regulation of hsFRP contributes to development of cervical cancer. |
potential | WNT pathway and mammary carcinogenesis: loss of expression of candidate tumor suppressor gene SFRP1 in most invasive carcinomas except of the medullary type. |
reviewed | Compensation by tumor suppressor genes during retinal development in mice and humans. |
| More detail of all 7 literatures about SFRP1 | |
Pathways and Diseases | |
Pathway | Wnt signaling pathway;KEGG PATHWAY;hsa04310 |
Pathway | Validated targets of C-MYC transcriptional repression;PID Curated;200171 |
Pathway | Wnt signaling pathway;PANTHER;P00057 |
Pathway | Angiogenesis;PANTHER;P00005 |
Disease | Metaplastic polyp;FunDO |
Disease | Barrett's esophagus;FunDO |
Disease | Retinal disease;FunDO |
Disease | Cancer;FunDO |
Disease | Glaucoma;FunDO |
External Links | |
Links to Entrez Gene | 6422 |
Links to all GeneRIF Items | 6422 |
Links to iHOP | 6422 |
Sequence Information | |
Nucleotide Sequence | >6422 : length: 945 atgggcatcgggcgcagcgaggggggccgccgcggggcagccctgggcgtgctgctggcg ctgggcgcggcgcttctggccgtgggctcggccagcgagtacgactacgtgagcttccag tcggacatcggcccgtaccagagcgggcgcttctacaccaagccacctcagtgcgtggac atccccgcggacctgcggctgtgccacaacgtgggctacaagaagatggtgctgcccaac ctgctggagcacgagaccatggcggaggtgaagcagcaggccagcagctgggtgcccctg ctcaacaagaactgccacgccggcacccaggtcttcctctgctcgctcttcgcgcccgtc tgcctggaccggcccatctacccgtgtcgctggctctgcgaggccgtgcgcgactcgtgc gagccggtcatgcagttcttcggcttctactggcccgagatgcttaagtgtgacaagttc cccgagggggacgtctgcatcgccatgacgccgcccaatgccaccgaagcctccaagccc caaggcacaacggtgtgtcctccctgtgacaacgagttgaaatctgaggccatcattgaa catctctgtgccagcgagtttgcactgaggatgaaaataaaagaagtgaaaaaagaaaat ggcgacaagaagattgtccccaagaagaagaagcccctgaagttggggcccatcaagaag aaggacctgaagaagcttgtgctgtacctgaagaatggggctgactgtccctgccaccag ctggacaacctcagccaccacttcctcatcatgggccgcaaggtgaagagccagtacttg ctgacggccatccacaagtgggacaagaaaaacaaggagttcaaaaacttcatgaagaaa atgaaaaaccatgagtgccccacctttcagtccgtgtttaagtga |
Protein Sequence | >6422 : length: 314 MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK MKNHECPTFQSVFK |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |