|
||
|
||
General information | Expression | Regulation | Mutation | Interaction |
Basic Information |
|
---|---|
Gene ID | 6767 |
Name | ST13 |
Synonym | AAG2|FAM10A1|FAM10A4|HIP|HOP|HSPABP|HSPABP1|P48|PRO0786|SNC6;suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein);ST13;suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) |
Definition | Hsp70-interacting protein|aging-associated protein 2|heat shock 70kD protein binding protein|hsc70-interacting protein|progesterone receptor-associated p48 protein|putative tumor suppressor ST13|renal carcinoma antigen NY-REN-33|suppression of tumorigenic |
Position | 22q13.2 |
Gene Type | protein-coding |
Source | Count: 2; TAG,Generif |
Literature support | Count: 2 PubMed records as below. |
Evidence Status |
Description |
potential | Assignment of human putative tumor suppressor genes ST13 (alias SNC6) and ST14 (alias SNC19) to human chromosome bands 22q13 and 11q24?q25 by in situ hybridization. |
potential | "Characterization of FAM10A4, a member of the ST13 tumor suppressor gene family that maps to the 13q14.3 region associated with B-Cell leukemia, multiple myeloma, and prostate cancer." |
More detail of all 2 literatures about ST13 | |
Pathways and Diseases |
|
Pathway | ifn alpha signaling pathway;PID BioCarta;100139 |
External Links |
|
Links to Entrez Gene | 6767 |
Links to all GeneRIF Items | 6767 |
Links to iHOP | 6767 |
Sequence Information |
|
Nucleotide Sequence |
>6767 : length: 1110 atggacccccgcaaagtgaacgagcttcgggcctttgtgaaaatgtgtaagcaggatccg agcgttctgcacaccgaggaaatgcgcttcctgagggagtgggtggagagcatgggtggt aaagtaccacctgctactcagaaagctaaatcagaagaaaataccaaggaagaaaaacct gatagtaagaaggtggaggaagacttaaaggcagacgaaccatcaagtgaggaaagtgat ctagaaattgataaagaaggtgtgattgaaccagacactgatgctcctcaagaaatggga gatgaaaatgcggagataacggaggagatgatggatcaggcaaatgataaaaaagtggct gctattgaagccctaaatgatggtgaactccagaaagccattgacttattcacagatgcc atcaagctgaatcctcgcttggccattttgtatgccaagagggccagtgtcttcgtcaaa ttacagaagccaaatgctgccatccgagactgtgacagagccattgaaataaatcctgat tcagctcagccttacaagtggcgggggaaagcacacagacttctaggccactgggaagaa gcagcccatgatcttgcccttgcctgtaaattggattatgatgaagatgctagtgcaatg ctgaaagaagttcaacctagggcacagaaaattgcagaacatcggagaaagtatgagcga aaacgtgaagagcgagagatcaaagaaagaatagaacgagttaagaaggctcgagaagag catgagagagcccagagggaggaagaagccagacgacagtcaggagctcagtatggctct tttccaggtggctttcctgggggaatgcctggtaattttcccggaggaatgcctggaatg ggagggggcatgcctggaatggctggaatgcctggactcaatgaaattcttagtgatcca gaggttcttgcagccatgcaggatccagaagttatggtggctttccaggatgtggctcag aacccagcaaatatgtcaaaataccagagcaacccaaaggttatgaatctcatcagtaaa ttgtcagccaaatttggaggtcaagcgtaa |
Protein Sequence |
>6767 : length: 369 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGNFPGGMPGM GGGMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK LSAKFGGQA |
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |