|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 6988 |
Name | TCTA |
Synonym | -;T-cell leukemia translocation altered gene;TCTA;T-cell leukemia translocation altered gene |
Definition | T-cell leukemia translocation-altered gene protein|T-cell leukemia translocation-associated gene protein |
Position | 3p21 |
Gene Type | protein-coding |
Source | Count: 1; TAG |
Literature support | Count: 0 PubMed records as below. |
|
Evidence Status |
Description |
| . |
| More detail of all 0 literatures about TCTA | |
|
External Links |
|
Links to Entrez Gene | 6988 |
Links to all GeneRIF Items | 6988 |
Links to iHOP | 6988 |
|
Sequence Information |
|
Nucleotide Sequence |
>6988 : length: 312 atggcggagtcctggtctgggcaggccttgcaggctctgccggccacggtgctgggcgcg ctgggcagcgagttcttgcgggagtgggaggcgcaggacatgcgcgtgaccctcttcaag ctgctgctgctgtggttggtgttaagtctcctgggcatccagctggcgtgggggttctac gggaatacagtgaccgggttgtatcaccgtccaggtctgggtggtcagaatggatccacg cctgatggctccacgcatttcccttcgtgggaaatggcagcaaacgaacctctcaaaacc cacagagaataa |
Protein Sequence |
>6988 : length: 103 MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFY GNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE |