|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
|
Basic Information |
|
|---|---|
Gene ID | 7070 |
Name | THY1 |
Synonym | CD90;Thy-1 cell surface antigen;THY1;Thy-1 cell surface antigen |
Definition | CDw90|Thy-1 T-cell antigen|thy-1 antigen|thy-1 membrane glycoprotein |
Position | 11q23.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 3 PubMed records as below. |
|
Evidence Status |
Description |
reviewed | Functional characterization of THY1 as a tumor suppressor gene with antiinvasive activity in nasopharyngeal carcinoma. |
potential | THY1 can be designated as a putative tumor suppressor gene for human ovarian cancer. |
potential | "THY1 is a putative tumor suppressor gene for ovarian cancer; and THBS1, SPARC, and FN1 are genes associated with the regulation of in vivo tumor growth rate". |
| More detail of all 3 literatures about THY1 | |
|
Pathways and Diseases |
|
Pathway | IL4-mediated signaling events;PID Curated;200018 |
Pathway | Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670 |
Pathway | amb2 Integrin signaling;PID Curated;200108 |
Disease | Cancer;FunDO |
Disease | Immunologic deficiency syndrome;FunDO |
|
External Links |
|
Links to Entrez Gene | 7070 |
Links to all GeneRIF Items | 7070 |
Links to iHOP | 7070 |
|
Sequence Information |
|
Nucleotide Sequence |
>7070 : length: 486 atgaacctggccatcagcatcgctctcctgctaacagtcttgcaggtctcccgagggcag aaggtgaccagcctaacggcctgcctagtggaccagagccttcgtctggactgccgccat gagaataccagcagttcacccatccagtacgagttcagcctgacccgtgagacaaagaag cacgtgctctttggcactgtgggggtgcctgagcacacataccgctcccgaaccaacttc accagcaaatacaacatgaaggtcctctacttatccgccttcactagcaaggacgagggc acctacacgtgtgcactccaccactctggccattccccacccatctcctcccagaacgtc acagtgctcagagacaaactggtcaagtgtgagggcatcagcctgctggctcagaacacc tcgtggctgctgctgctcctgctctccctctccctcctccaggccacggatttcatgtcc ctgtga |
Protein Sequence |
>7070 : length: 161 MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKK HVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNV TVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL |