|
|
||
|
|
||
| General information | Expression | Regulation | Mutation | Interaction |
Basic Information | |
|---|---|
Gene ID | 7078 |
Name | TIMP3 |
Synonym | HSMRK222|K222|K222TA2|SFD;TIMP metallopeptidase inhibitor 3;TIMP3;TIMP metallopeptidase inhibitor 3 |
Definition | MIG-5 protein|TIMP-3|metalloproteinase inhibitor 3|protein MIG-5|tissue inhibitor of metalloproteinases 3 |
Position | 22q12.1-q13.2|22q12.3 |
Gene Type | protein-coding |
Source | Count: 2; Pubmed_search,Generif |
Literature support | Count: 5 PubMed records as below. |
Evidence Status | Description |
reviewed | "show that miR-221&222, by targeting PTEN and TIMP3 tumor suppressors, induce TRAIL resistance and enhance cellular migration through the activation of the AKT pathway and metallopeptidases". |
reviewed | "These results suggest that the conspicuous expression of the tumor suppressor genes BEX2, IGSF4 and TIMP3 in MLLmu acute myeloid leukemias cell lines is the consequence of altered epigenetic properties of MLL fusion proteins." |
potential | candidate tumor suppressor gene in the biliary tree. |
potential | "TIMP3, DAPK1 and AKR1B10 are important for squamous cell lung cancer tumorogenesis while AKR1B10 is potential oncogene whereas TIMP3 and DAPK1 are potential tumor suppressor genes." |
reviewed | "Association of aberrant methylation of tumor suppressor genes with tumor aggressiveness and BRAF mutation in papillary thyroid cancer. we first demonstrated the functional consequence of methylation of several recently identified tumor suppressor genes, including those for tissue inhibitor of metalloproteinase-3 (TIMP3), SLC5A8, death-associated protein kinase (DAPK) and retinoic acid receptor beta2 (RARbeta2). ". |
| More detail of all 5 literatures about TIMP3 | |
Pathways and Diseases | |
Pathway | inhibition of matrix metalloproteinases;PID BioCarta;100045 |
Pathway | p53 signaling pathway;PID BioCarta;100083 |
Disease | Age-related macular degeneration;NHGRI |
Disease | Choriocarcinoma;FunDO |
Disease | Heart failure;FunDO |
Disease | Hamman-Rich syndrome;FunDO |
Disease | Diabetes mellitus;FunDO |
Disease | Intracranial aneurysm;FunDO |
Disease | Macular degeneration;FunDO |
Disease | CARDIOVASCULAR;GAD |
Disease | Rheumatoid arthritis;FunDO |
Disease | Sorsby fundus dystrophy;OMIM |
Disease | Congenital abnormality;FunDO |
Disease | Pigeon breeders disease;GAD |
Disease | Cancer;FunDO |
Disease | pulmonary fibrosis;GAD |
Disease | Aortic aneurysm;FunDO |
Disease | Bronchial disease;FunDO |
External Links | |
Links to Entrez Gene | 7078 |
Links to all GeneRIF Items | 7078 |
Links to iHOP | 7078 |
Sequence Information | |
Nucleotide Sequence | >7078 : length: 636 atgaccccttggctcgggctcatcgtgctcctgggcagctggagcctgggggactggggc gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactccgacatc gtgatccgggccaaggtggtggggaagaagctggtaaaggaggggcccttcggcacgctg gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccatgtgcag tacatccatacggaagcttccgagagtctctgtggccttaagctggaggtcaacaagtac cagtacctgctgacaggtcgcgtctatgatggcaagatgtacacggggctgtgcaacttc gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaactatcggtatcac ctgggttgtaactgcaagatcaagtcctgctactacctgccttgctttgtgacttccaag aacgagtgtctctggaccgacatgctctccaatttcggttaccctggctaccagtccaaa cactacgcctgcatccggcagaagggcggctactgcagctggtaccgaggatgggccccc ccggataaaagcatcatcaatgccacagacccctga |
Protein Sequence | >7078 : length: 211 MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK HYACIRQKGGYCSWYRGWAPPDKSIINATDP |
|
Copyright © 2016-Present - The Univsersity of Texas Health Science Center at Houston Rights Reserved |